SimulationCraft 902-01

for World of Warcraft 9.0.2.36639 Live (wow build level 36639)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Forgelite : 10775 dps, 4796 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10774.6 10774.6 16.1 / 0.150% 1151.2 / 10.7% 5.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
1988.8 1893.4 Mana 0.00% 49.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Forgelite 10775
Arcane Barrage 3904 36.3% 55.4 5.42sec 21175 16990 Direct 166.0 5925 11868 7070 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.40 166.00 0.00 0.00 1.2463 0.0000 1173047.94 1173047.94 0.00% 16990.11 16990.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 134.03 100 173 5924.93 2082 30168 5916.80 5106 6593 794014 794014 0.00%
crit 19.26% 31.97 15 52 11868.09 4164 60336 11828.62 7398 16373 379034 379034 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.40
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 372 3.5% 59.4 4.70sec 1882 0 Direct 178.1 526 1053 627 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.35 178.06 0.00 0.00 0.0000 0.0000 111683.55 111683.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 143.82 107 192 525.87 316 664 525.46 484 569 75621 75621 0.00%
crit 19.23% 34.25 16 56 1053.29 633 1329 1052.39 928 1181 36063 36063 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4456 41.3% 148.7 1.99sec 8992 7237 Direct 446.0 2512 5030 2998 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.67 446.00 0.00 0.00 1.2424 0.0000 1336732.61 1336732.61 0.00% 7237.12 7237.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 359.98 275 448 2512.12 1958 5756 2511.41 2410 2608 904124 904124 0.00%
crit 19.29% 86.02 54 126 5029.90 3916 11512 5027.92 4517 5662 432609 432609 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:148.66
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (845) 0.0% (7.8%) 12.8 24.09sec 19779 15873

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.81 0.00 0.00 0.00 1.2461 0.0000 0.00 0.00 0.00% 15873.32 15873.32

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.81
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 845 7.8% 38.4 24.10sec 6601 0 Direct 38.4 5505 11054 6600 19.8%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.39 38.39 0.00 0.00 0.0000 0.0000 253385.73 253385.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.24% 30.80 18 45 5505.30 3869 8938 5503.92 4914 6134 169529 169529 0.00%
crit 19.76% 7.58 0 16 11054.35 7739 17876 11025.87 0 15348 83857 83857 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.6%) 14.7 1.77sec 1387 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.68 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.6% 14.7 1.77sec 1387 0 Direct 14.7 1164 2327 1388 19.2%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.68 14.68 0.00 0.00 0.0000 0.0000 20362.27 20362.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 11.86 5 20 1163.53 1164 1164 1163.53 1164 1164 13804 13804 0.00%
crit 19.20% 2.82 0 9 2327.06 2327 2327 2219.98 0 2327 6559 6559 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1783 20.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1781.19 1781.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 0.80 0 1 1480.68 1481 1481 1180.16 0 1481 1180 1180 0.00%
crit 20.30% 0.20 0 1 2961.35 2961 2961 601.03 0 2961 601 601 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5789 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.2% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5789.34 5789.34 0.00% 49.15 49.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 72.65 59 83 53.93 43 60 53.93 53 56 3918 3918 0.00%
crit 19.27% 17.35 7 31 107.89 86 120 107.90 93 119 1871 1871 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 181 1.7% 9.3 33.83sec 5859 4600 Direct 9.3 2857 5754 3416 19.3%
Periodic 60.5 315 630 375 19.1% 10.2%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.29 9.29 60.48 60.48 1.2736 1.5125 54418.73 54418.73 0.00% 526.74 4600.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 7.49 2 11 2857.00 2693 5655 2861.19 2693 3680 21397 21397 0.00%
crit 19.33% 1.80 0 7 5754.40 5386 11310 4976.26 0 11310 10336 10336 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.92% 48.95 30 69 315.10 34 501 314.75 273 351 15417 15417 0.00%
crit 19.08% 11.54 2 26 629.73 68 1003 631.35 438 1003 7268 7268 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.55
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.79
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.98
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (908) 0.0% (8.4%) 5.9 54.44sec 45811 36477

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 0.00 0.00 0.00 1.2560 0.0000 0.00 0.00 0.00% 36477.08 36477.08

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.97
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 908 8.4% 5.9 54.34sec 45811 0 Direct 17.8 15307 0 15307 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 17.79 0.00 0.00 0.0000 0.0000 272191.94 272191.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 17.79 15 21 15306.87 109 55841 15304.01 11535 18880 272192 272192 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20273.79
  • base_dd_max:20273.79
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
pet - bron 72 / 14
melee 72 0.1% 17.4 9.09sec 236 182 Direct 17.4 198 396 236 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.41 17.41 0.00 0.00 1.2989 0.0000 4112.43 5874.19 29.99% 181.82 181.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 14.04 6 19 197.88 176 247 197.72 176 233 2778 3969 29.99%
crit 19.35% 3.37 0 10 396.15 353 494 385.09 0 494 1334 1906 29.18%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Kyrian_Forgelite
Arcane Power 2.8 131.66sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.78
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 263.08sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.78
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.0 175.64sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 5.95 0.00 4.3236 0.7227 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:1.00
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 52.27sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.83 0.00 0.00 0.00 1.2551 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.86
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.73sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
pet - bron
Anima Cannon 7.6 22.58sec

Stats Details: Anima Cannon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Anima Cannon

  • id:332525
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:8.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332525
  • name:Anima Cannon
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:7.60
Vitalizing Bolt (goliath_support) 13.3 12.14sec

Stats Details: Goliath Support

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 13.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Goliath Support

  • id:332526
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:4.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite_bron
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332526
  • name:Vitalizing Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:13.33
Smash 7.5 22.66sec

Stats Details: Smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.53 0.00 0.00 0.00 2.1654 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Smash

  • id:341163
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:3.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:341163
  • name:Smash
  • school:physical
  • tooltip:
  • description:Attacks the ground with a heavy smash, inflicting Arcane damage to all enemies in a cone in front of the caster.

Action Priority List

    default
    [ ]:7.60

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.1 149.7 5.3sec 1.4sec 3.9sec 72.15% 0.00% 0.1 (0.2) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.73%
  • arcane_charge_2:16.01%
  • arcane_charge_3:16.03%
  • arcane_charge_4:21.38%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 131.5sec 131.5sec 14.7sec 13.57% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.57%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 262.7sec 262.7sec 11.7sec 6.85% 23.15% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.0s / 272.0s
  • trigger_min/max:241.0s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:6.85%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bron's Call to Action 3.0 220.8 118.9sec 1.3sec 99.0sec 99.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_brons_call_to_action
  • max_stacks:89
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:109.2s / 134.1s
  • trigger_min/max:0.9s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 132.8s

Stack Uptimes

  • brons_call_to_action_1:1.42%
  • brons_call_to_action_2:1.25%
  • brons_call_to_action_3:1.31%
  • brons_call_to_action_4:1.37%
  • brons_call_to_action_5:1.20%
  • brons_call_to_action_6:1.59%
  • brons_call_to_action_7:1.16%
  • brons_call_to_action_8:1.16%
  • brons_call_to_action_9:1.15%
  • brons_call_to_action_10:1.14%
  • brons_call_to_action_11:1.14%
  • brons_call_to_action_12:1.14%
  • brons_call_to_action_13:1.22%
  • brons_call_to_action_14:1.26%
  • brons_call_to_action_15:1.11%
  • brons_call_to_action_16:1.12%
  • brons_call_to_action_17:1.19%
  • brons_call_to_action_18:1.28%
  • brons_call_to_action_19:1.74%
  • brons_call_to_action_20:1.28%
  • brons_call_to_action_21:1.13%
  • brons_call_to_action_22:1.10%
  • brons_call_to_action_23:1.07%
  • brons_call_to_action_24:1.06%
  • brons_call_to_action_25:1.12%
  • brons_call_to_action_26:1.06%
  • brons_call_to_action_27:1.05%
  • brons_call_to_action_28:1.05%
  • brons_call_to_action_29:1.06%
  • brons_call_to_action_30:1.04%
  • brons_call_to_action_31:1.04%
  • brons_call_to_action_32:1.39%
  • brons_call_to_action_33:1.17%
  • brons_call_to_action_34:1.05%
  • brons_call_to_action_35:1.05%
  • brons_call_to_action_36:1.07%
  • brons_call_to_action_37:1.11%
  • brons_call_to_action_38:1.05%
  • brons_call_to_action_39:1.02%
  • brons_call_to_action_40:1.02%
  • brons_call_to_action_41:1.11%
  • brons_call_to_action_42:1.37%
  • brons_call_to_action_43:1.16%
  • brons_call_to_action_44:1.12%
  • brons_call_to_action_45:1.13%
  • brons_call_to_action_46:1.11%
  • brons_call_to_action_47:1.08%
  • brons_call_to_action_48:1.10%
  • brons_call_to_action_49:1.07%
  • brons_call_to_action_50:1.06%
  • brons_call_to_action_51:1.06%
  • brons_call_to_action_52:1.06%
  • brons_call_to_action_53:1.14%
  • brons_call_to_action_54:1.06%
  • brons_call_to_action_55:1.06%
  • brons_call_to_action_56:1.04%
  • brons_call_to_action_57:1.04%
  • brons_call_to_action_58:1.05%
  • brons_call_to_action_59:1.50%
  • brons_call_to_action_60:1.13%
  • brons_call_to_action_61:1.02%
  • brons_call_to_action_62:1.05%
  • brons_call_to_action_63:1.01%
  • brons_call_to_action_64:1.01%
  • brons_call_to_action_65:1.23%
  • brons_call_to_action_66:0.99%
  • brons_call_to_action_67:1.03%
  • brons_call_to_action_68:1.03%
  • brons_call_to_action_69:0.98%
  • brons_call_to_action_70:1.00%
  • brons_call_to_action_71:1.01%
  • brons_call_to_action_72:1.01%
  • brons_call_to_action_73:0.98%
  • brons_call_to_action_74:1.09%
  • brons_call_to_action_75:1.00%
  • brons_call_to_action_76:1.14%
  • brons_call_to_action_77:1.04%
  • brons_call_to_action_78:0.93%
  • brons_call_to_action_79:1.09%
  • brons_call_to_action_80:0.93%
  • brons_call_to_action_81:0.92%
  • brons_call_to_action_82:1.35%
  • brons_call_to_action_83:0.98%
  • brons_call_to_action_84:1.01%
  • brons_call_to_action_85:0.93%
  • brons_call_to_action_86:0.90%
  • brons_call_to_action_87:0.91%
  • brons_call_to_action_88:1.11%
  • brons_call_to_action_89:0.98%

Spelldata

  • id:332514
  • name:Bron's Call to Action
  • tooltip:Bron arrives in ${{$332514u=89}+1-$w1} damaging or healing spells or abilities.
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}
  • max_stacks:89
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 24.0 0.2 12.1sec 12.0sec 2.1sec 16.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.24%
  • clearcasting_2:0.23%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.0 0.0 173.5sec 173.5sec 4.3sec 1.44% 0.00% 4.0 (4.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:114.1s / 253.9s
  • trigger_min/max:114.1s / 253.9s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 4.3s

Stack Uptimes

  • evocation_1:1.44%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.2sec 36.2sec 11.8sec 33.82% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 55.3s
  • trigger_min/max:15.7s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:33.82%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.46% 0.82% 6.60% 0.9s 0.0s 5.4s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.091120.122239.871
Evocation168.17924.095350.952226.877138.522358.408
Rune of Power8.1181.13824.69448.65431.84677.444
Touch of the Magi7.0681.13824.45843.53330.54176.989
Arcane Power8.1730.36818.93623.3492.69634.266
Arcane Barrage2.9200.0029.587162.957128.959197.071
Arcane Orb4.0330.01811.79652.08139.44068.943
Radiant Spark2.3450.00022.28322.2159.69958.631

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Forgelite
mana_regen Mana 623.91 368669.40 64.88% 590.90 11048.25 2.91%
Evocation Mana 47.61 47942.98 8.44% 1007.03 0.00 0.00%
Mana Gem Mana 2.73 17320.50 3.05% 6337.14 0.00 0.00%
Arcane Barrage Mana 55.40 134260.49 23.63% 2423.48 6170.18 4.39%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1893.41 1988.76 17185.2 34756.3 673.7 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Forgelite
arcane_explosion Mana 148.7 566046.2 3807.7 3807.5 2.4
arcane_orb Mana 12.8 5732.4 447.4 447.5 44.2
radiant_spark Mana 9.3 9140.3 984.4 984.1 6.0
touch_of_the_magi Mana 5.9 14856.0 2500.0 2500.3 18.3

Statistics & Data Analysis

Fight Length
Kyrian_Forgelite Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Kyrian_Forgelite Damage Per Second
Count 1217
Mean 10774.59
Minimum 9884.09
Maximum 11744.75
Spread ( max - min ) 1860.67
Range [ ( max - min ) / 2 * 100% ] 8.63%
Standard Deviation 286.7198
5th Percentile 10278.76
95th Percentile 11228.73
( 95th Percentile - 5th Percentile ) 949.97
Mean Distribution
Standard Deviation 8.2189
95.00% Confidence Interval ( 10758.48 - 10790.70 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2721
0.1 Scale Factor Error with Delta=300 702
0.05 Scale Factor Error with Delta=300 2808
0.01 Scale Factor Error with Delta=300 70178
Priority Target DPS
Kyrian_Forgelite Priority Target Damage Per Second
Count 1217
Mean 4795.65
Minimum 4260.07
Maximum 5418.93
Spread ( max - min ) 1158.86
Range [ ( max - min ) / 2 * 100% ] 12.08%
Standard Deviation 173.8023
5th Percentile 4518.51
95th Percentile 5076.30
( 95th Percentile - 5th Percentile ) 557.79
Mean Distribution
Standard Deviation 4.9821
95.00% Confidence Interval ( 4785.89 - 4805.42 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5046
0.1 Scale Factor Error with Delta=300 258
0.05 Scale Factor Error with Delta=300 1032
0.01 Scale Factor Error with Delta=300 25787
DPS(e)
Kyrian_Forgelite Damage Per Second (Effective)
Count 1217
Mean 10774.59
Minimum 9884.09
Maximum 11744.75
Spread ( max - min ) 1860.67
Range [ ( max - min ) / 2 * 100% ] 8.63%
Damage
Kyrian_Forgelite Damage
Count 1217
Mean 3223603.97
Minimum 2470436.22
Maximum 3953028.67
Spread ( max - min ) 1482592.45
Range [ ( max - min ) / 2 * 100% ] 23.00%
DTPS
Kyrian_Forgelite Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Forgelite Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Forgelite Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Forgelite Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Forgelite Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Forgelite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_ForgeliteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Forgelite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.55 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.79 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.98 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.97 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.78 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.86 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.81 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 148.66 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.40 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 1.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.78 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqqtrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqrtprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrjqqqqrqqqqrprqqqqrqqqqrqqqtqrkmnvrprqqqqrqqqqorqqqqrprqqjqqrqqqqrqqqqrprqqqqrqqskmorprqqqqrqqqqrq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe m touch_of_the_magi Fluffy_Pillow 62376.5/63371: 98% mana bloodlust
0:02.313 aoe n arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4)
0:02.313 shared_cds u potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:02.313 shared_cds v berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.313 aoe r arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.227 aoe p arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.141 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.054 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.969 aoe q arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.885 aoe q arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.800 aoe q arcane_explosion Fluffy_Pillow 59351.8/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:08.715 aoe r arcane_barrage Fluffy_Pillow 60511.5/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.631 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.545 aoe q arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.461 aoe q arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.375 aoe q arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.289 aoe r arcane_barrage Fluffy_Pillow 58007.7/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:14.203 aoe q arcane_explosion Fluffy_Pillow 61701.0/63371: 97% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:15.119 aoe q arcane_explosion Fluffy_Pillow 62861.9/63371: 99% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:16.126 aoe q arcane_explosion Fluffy_Pillow 61638.2/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:17.132 aoe q arcane_explosion Fluffy_Pillow 60413.3/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:18.140 aoe o rune_of_power Fluffy_Pillow 59190.8/63371: 93% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.146 aoe r arcane_barrage Fluffy_Pillow 60465.9/63371: 95% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.152 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.158 aoe q arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.164 aoe q arcane_explosion Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, potion_of_deathly_fixation
0:23.170 aoe q arcane_explosion Fluffy_Pillow 57196.5/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.176 shared_cds t use_mana_gem Kyrian_Forgelite 53471.6/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.176 aoe r arcane_barrage Fluffy_Pillow 59808.7/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.182 aoe p arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.189 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.193 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.199 aoe q arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.207 aoe q arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.211 aoe q arcane_explosion Fluffy_Pillow 52196.5/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.218 aoe r arcane_barrage Fluffy_Pillow 48472.8/63371: 76% mana bloodlust, arcane_charge(4), clearcasting
0:32.224 aoe j radiant_spark Fluffy_Pillow 52282.7/63371: 83% mana bloodlust, clearcasting
0:33.230 aoe q arcane_explosion Fluffy_Pillow 52557.8/63371: 83% mana bloodlust, clearcasting
0:34.236 aoe q arcane_explosion Fluffy_Pillow 53832.8/63371: 85% mana bloodlust, arcane_charge
0:35.243 aoe q arcane_explosion Fluffy_Pillow 50109.1/63371: 79% mana bloodlust, arcane_charge(2)
0:36.251 aoe q arcane_explosion Fluffy_Pillow 46386.7/63371: 73% mana bloodlust, arcane_charge(3)
0:37.257 aoe r arcane_barrage Fluffy_Pillow 42661.7/63371: 67% mana bloodlust, arcane_charge(4), clearcasting
0:38.264 aoe q arcane_explosion Fluffy_Pillow 46472.8/63371: 73% mana bloodlust, clearcasting
0:39.270 aoe q arcane_explosion Fluffy_Pillow 47747.9/63371: 75% mana bloodlust, arcane_charge
0:40.280 aoe q arcane_explosion Fluffy_Pillow 44028.0/63371: 69% mana bloodlust, arcane_charge(2), clearcasting
0:41.287 aoe q arcane_explosion Fluffy_Pillow 45304.3/63371: 71% mana arcane_charge(3)
0:42.594 aoe r arcane_barrage Fluffy_Pillow 41960.8/63371: 66% mana arcane_charge(4)
0:43.899 aoe q arcane_explosion Fluffy_Pillow 46149.7/63371: 73% mana
0:45.206 aoe q arcane_explosion Fluffy_Pillow 42806.2/63371: 68% mana arcane_charge
0:46.512 aoe q arcane_explosion Fluffy_Pillow 39461.5/63371: 62% mana arcane_charge(2)
0:47.818 aoe q arcane_explosion Fluffy_Pillow 36116.7/63371: 57% mana arcane_charge(3)
0:49.127 aoe r arcane_barrage Fluffy_Pillow 32775.8/63371: 52% mana arcane_charge(4), clearcasting
0:50.434 aoe p arcane_orb Fluffy_Pillow 36967.2/63371: 58% mana clearcasting
0:51.741 aoe r arcane_barrage Fluffy_Pillow 38123.7/63371: 60% mana arcane_charge(4), clearcasting
0:53.048 aoe q arcane_explosion Fluffy_Pillow 42315.1/63371: 67% mana clearcasting
0:54.355 aoe q arcane_explosion Fluffy_Pillow 43971.6/63371: 69% mana arcane_charge
0:55.663 aoe q arcane_explosion Fluffy_Pillow 40629.4/63371: 64% mana arcane_charge(2)
0:56.970 aoe q arcane_explosion Fluffy_Pillow 37285.9/63371: 59% mana arcane_charge(3), clearcasting
0:58.276 aoe r arcane_barrage Fluffy_Pillow 38941.2/63371: 61% mana arcane_charge(4)
0:59.584 aoe q arcane_explosion Fluffy_Pillow 43133.9/63371: 68% mana
1:00.891 aoe q arcane_explosion Fluffy_Pillow 39790.4/63371: 63% mana arcane_charge
1:02.197 aoe q arcane_explosion Fluffy_Pillow 36445.6/63371: 58% mana arcane_charge(2)
1:03.504 aoe q arcane_explosion Fluffy_Pillow 33102.2/63371: 52% mana arcane_charge(3)
1:04.809 aoe r arcane_barrage Fluffy_Pillow 29756.2/63371: 47% mana arcane_charge(4)
1:06.116 aoe k radiant_spark Fluffy_Pillow 33947.6/63371: 54% mana
1:07.423 aoe m touch_of_the_magi Fluffy_Pillow 34604.1/63371: 55% mana
1:08.729 aoe o rune_of_power Fluffy_Pillow 33759.3/63371: 53% mana arcane_charge(4)
1:10.034 aoe r arcane_barrage Fluffy_Pillow 35413.3/63371: 56% mana arcane_charge(4), rune_of_power
1:11.343 aoe p arcane_orb Fluffy_Pillow 39607.3/63371: 63% mana rune_of_power
1:12.651 aoe r arcane_barrage Fluffy_Pillow 40765.1/63371: 64% mana arcane_charge(4), rune_of_power
1:13.959 aoe q arcane_explosion Fluffy_Pillow 44957.7/63371: 71% mana rune_of_power
1:15.266 aoe q arcane_explosion Fluffy_Pillow 41614.2/63371: 66% mana arcane_charge, rune_of_power
1:16.573 aoe q arcane_explosion Fluffy_Pillow 38270.8/63371: 60% mana arcane_charge(2), rune_of_power
1:17.880 aoe q arcane_explosion Fluffy_Pillow 34927.3/63371: 55% mana arcane_charge(3), clearcasting, rune_of_power
1:19.186 aoe r arcane_barrage Fluffy_Pillow 36582.6/63371: 58% mana arcane_charge(4), rune_of_power
1:20.491 aoe q arcane_explosion Fluffy_Pillow 40771.4/63371: 64% mana rune_of_power
1:21.798 aoe q arcane_explosion Fluffy_Pillow 37427.9/63371: 59% mana arcane_charge, rune_of_power
1:23.104 aoe q arcane_explosion Fluffy_Pillow 34083.2/63371: 54% mana arcane_charge(2)
1:24.409 aoe q arcane_explosion Fluffy_Pillow 30737.2/63371: 49% mana arcane_charge(3)
1:25.717 aoe r arcane_barrage Fluffy_Pillow 27395.0/63371: 43% mana arcane_charge(4)
1:27.023 aoe q arcane_explosion Fluffy_Pillow 31585.1/63371: 50% mana
1:28.330 aoe q arcane_explosion Fluffy_Pillow 28241.6/63371: 45% mana arcane_charge, clearcasting
1:29.636 aoe q arcane_explosion Fluffy_Pillow 29896.9/63371: 47% mana arcane_charge(2)
1:30.943 aoe q arcane_explosion Fluffy_Pillow 26553.4/63371: 42% mana arcane_charge(3)
1:32.249 aoe r arcane_barrage Fluffy_Pillow 23208.7/63371: 37% mana arcane_charge(4)
1:33.556 aoe p arcane_orb Fluffy_Pillow 27400.1/63371: 43% mana
1:34.863 aoe r arcane_barrage Fluffy_Pillow 28556.6/63371: 45% mana arcane_charge(4)
1:36.171 aoe q arcane_explosion Fluffy_Pillow 32749.3/63371: 52% mana
1:37.477 aoe j radiant_spark Fluffy_Pillow 29404.5/63371: 46% mana arcane_charge
1:38.783 aoe q arcane_explosion Fluffy_Pillow 30059.8/63371: 47% mana arcane_charge
1:40.088 aoe q arcane_explosion Fluffy_Pillow 26713.8/63371: 42% mana arcane_charge(2)
1:41.394 aoe q arcane_explosion Fluffy_Pillow 23369.0/63371: 37% mana arcane_charge(3)
1:42.699 aoe r arcane_barrage Fluffy_Pillow 20023.0/63371: 32% mana arcane_charge(4)
1:44.006 aoe q arcane_explosion Fluffy_Pillow 24214.4/63371: 38% mana
1:45.312 aoe q arcane_explosion Fluffy_Pillow 20869.7/63371: 33% mana arcane_charge
1:46.618 aoe q arcane_explosion Fluffy_Pillow 17524.9/63371: 28% mana arcane_charge(2), clearcasting
1:47.926 aoe q arcane_explosion Fluffy_Pillow 19182.7/63371: 30% mana arcane_charge(3)
1:49.232 aoe r arcane_barrage Fluffy_Pillow 15838.0/63371: 25% mana arcane_charge(4)
1:50.540 aoe q arcane_explosion Fluffy_Pillow 20030.7/63371: 32% mana brons_call_to_action
1:51.848 aoe q arcane_explosion Fluffy_Pillow 16688.5/63371: 26% mana arcane_charge, brons_call_to_action(2)
1:53.154 aoe q arcane_explosion Fluffy_Pillow 13343.7/63371: 21% mana arcane_charge(2), brons_call_to_action(3)
1:54.460 aoe q arcane_explosion Fluffy_Pillow 9999.0/63371: 16% mana arcane_charge(3), brons_call_to_action(4)
1:55.767 aoe r arcane_barrage Fluffy_Pillow 6655.5/63371: 11% mana arcane_charge(4), clearcasting, brons_call_to_action(5)
1:57.074 aoe m touch_of_the_magi Fluffy_Pillow 10846.9/63371: 17% mana clearcasting, brons_call_to_action(6)
1:58.382 aoe o rune_of_power Fluffy_Pillow 10004.7/63371: 16% mana arcane_charge(4), clearcasting, brons_call_to_action(7)
1:59.688 aoe r arcane_barrage Fluffy_Pillow 11659.9/63371: 18% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(8)
2:00.996 aoe p arcane_orb Fluffy_Pillow 15852.6/63371: 25% mana clearcasting, rune_of_power, brons_call_to_action(8)
2:02.303 aoe r arcane_barrage Fluffy_Pillow 17009.1/63371: 27% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(9)
2:03.610 aoe q arcane_explosion Fluffy_Pillow 21200.5/63371: 33% mana clearcasting, rune_of_power, brons_call_to_action(10)
2:04.916 aoe q arcane_explosion Fluffy_Pillow 22855.8/63371: 36% mana arcane_charge, rune_of_power, brons_call_to_action(11)
2:06.223 aoe q arcane_explosion Fluffy_Pillow 19512.3/63371: 31% mana arcane_charge(2), rune_of_power, brons_call_to_action(12)
2:07.531 aoe q arcane_explosion Fluffy_Pillow 16170.1/63371: 26% mana arcane_charge(3), rune_of_power, brons_call_to_action(13)
2:08.837 aoe r arcane_barrage Fluffy_Pillow 12825.4/63371: 20% mana arcane_charge(4), rune_of_power, brons_call_to_action(14)
2:10.143 aoe q arcane_explosion Fluffy_Pillow 17015.5/63371: 27% mana rune_of_power, brons_call_to_action(15)
2:11.451 aoe q arcane_explosion Fluffy_Pillow 13673.3/63371: 22% mana arcane_charge, rune_of_power, brons_call_to_action(16)
2:12.755 aoe q arcane_explosion Fluffy_Pillow 10326.0/63371: 16% mana arcane_charge(2), clearcasting, brons_call_to_action(17)
2:14.059 aoe q arcane_explosion Fluffy_Pillow 11978.7/63371: 19% mana arcane_charge(3), brons_call_to_action(18)
2:15.364 aoe l radiant_spark Fluffy_Pillow 8632.7/63371: 14% mana arcane_charge(4), brons_call_to_action(19)
2:16.669 aoe n arcane_power Fluffy_Pillow 9286.7/63371: 15% mana arcane_charge(4), brons_call_to_action(20)
2:16.669 aoe r arcane_barrage Fluffy_Pillow 9286.7/63371: 15% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(20)
2:17.977 aoe q arcane_explosion Fluffy_Pillow 13479.4/63371: 21% mana arcane_power, rune_of_power, brons_call_to_action(20)
2:19.282 aoe q arcane_explosion Fluffy_Pillow 12633.4/63371: 20% mana arcane_charge, arcane_power, rune_of_power, brons_call_to_action(21)
2:20.586 aoe q arcane_explosion Fluffy_Pillow 11786.1/63371: 19% mana arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(22)
2:21.891 aoe q arcane_explosion Fluffy_Pillow 10940.1/63371: 17% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(23)
2:23.197 aoe r arcane_barrage Fluffy_Pillow 10095.4/63371: 16% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(24)
2:24.503 shared_cds t use_mana_gem Kyrian_Forgelite 14285.5/63371: 23% mana arcane_power, rune_of_power, brons_call_to_action(25)
2:24.503 aoe p arcane_orb Fluffy_Pillow 20622.6/63371: 33% mana arcane_power, rune_of_power, brons_call_to_action(25)
2:25.810 aoe r arcane_barrage Fluffy_Pillow 22029.1/63371: 35% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(26)
2:27.115 aoe q arcane_explosion Fluffy_Pillow 26218.0/63371: 41% mana arcane_power, rune_of_power, brons_call_to_action(27)
2:28.421 aoe q arcane_explosion Fluffy_Pillow 25373.3/63371: 40% mana arcane_charge, arcane_power, rune_of_power, brons_call_to_action(28)
2:29.728 aoe q arcane_explosion Fluffy_Pillow 24529.8/63371: 39% mana arcane_charge(2), arcane_power, brons_call_to_action(29)
2:31.034 aoe q arcane_explosion Fluffy_Pillow 23685.1/63371: 37% mana arcane_charge(3), arcane_power, clearcasting, brons_call_to_action(30)
2:32.342 aoe r arcane_barrage Fluffy_Pillow 25342.8/63371: 40% mana arcane_charge(4), brons_call_to_action(31)
2:33.648 aoe q arcane_explosion Fluffy_Pillow 29533.0/63371: 47% mana brons_call_to_action(32)
2:34.955 aoe q arcane_explosion Fluffy_Pillow 26189.5/63371: 41% mana arcane_charge, brons_call_to_action(33)
2:36.263 aoe q arcane_explosion Fluffy_Pillow 22847.3/63371: 36% mana arcane_charge(2), brons_call_to_action(34)
2:37.570 aoe q arcane_explosion Fluffy_Pillow 19503.8/63371: 31% mana arcane_charge(3), clearcasting, brons_call_to_action(35)
2:38.877 aoe r arcane_barrage Fluffy_Pillow 21160.3/63371: 33% mana arcane_charge(4), brons_call_to_action(36)
2:40.184 aoe q arcane_explosion Fluffy_Pillow 25351.7/63371: 40% mana brons_call_to_action(37)
2:41.490 aoe q arcane_explosion Fluffy_Pillow 22007.0/63371: 35% mana arcane_charge, brons_call_to_action(38)
2:42.799 aoe q arcane_explosion Fluffy_Pillow 18666.1/63371: 29% mana arcane_charge(2), brons_call_to_action(39)
2:44.107 aoe q arcane_explosion Fluffy_Pillow 15323.9/63371: 24% mana arcane_charge(3), brons_call_to_action(40)
2:45.413 aoe r arcane_barrage Fluffy_Pillow 11979.1/63371: 19% mana arcane_charge(4), clearcasting, brons_call_to_action(41)
2:46.719 aoe k radiant_spark Fluffy_Pillow 16169.2/63371: 26% mana clearcasting, brons_call_to_action(42)
2:48.026 aoe m touch_of_the_magi Fluffy_Pillow 16825.8/63371: 27% mana clearcasting, brons_call_to_action(43)
2:49.334 aoe o rune_of_power Fluffy_Pillow 15983.6/63371: 25% mana arcane_charge(4), clearcasting, brons_call_to_action(44)
2:50.639 aoe r arcane_barrage Fluffy_Pillow 17637.6/63371: 28% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(45)
2:51.947 aoe p arcane_orb Fluffy_Pillow 21830.2/63371: 34% mana clearcasting, rune_of_power, brons_call_to_action(45)
2:53.254 aoe r arcane_barrage Fluffy_Pillow 22986.7/63371: 36% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(46)
2:54.562 aoe q arcane_explosion Fluffy_Pillow 27179.4/63371: 43% mana clearcasting, rune_of_power, brons_call_to_action(47)
2:55.868 aoe q arcane_explosion Fluffy_Pillow 28834.7/63371: 46% mana arcane_charge, rune_of_power, brons_call_to_action(48)
2:57.175 aoe q arcane_explosion Fluffy_Pillow 25491.2/63371: 40% mana arcane_charge(2), rune_of_power, brons_call_to_action(49)
2:58.481 aoe q arcane_explosion Fluffy_Pillow 22146.4/63371: 35% mana arcane_charge(3), rune_of_power, brons_call_to_action(50)
2:59.788 aoe r arcane_barrage Fluffy_Pillow 18803.0/63371: 30% mana arcane_charge(4), rune_of_power, brons_call_to_action(51)
3:01.095 aoe q arcane_explosion Fluffy_Pillow 22994.4/63371: 36% mana rune_of_power, brons_call_to_action(52)
3:02.401 aoe q arcane_explosion Fluffy_Pillow 19649.6/63371: 31% mana arcane_charge, rune_of_power, brons_call_to_action(53)
3:03.708 aoe q arcane_explosion Fluffy_Pillow 16306.2/63371: 26% mana arcane_charge(2), clearcasting, brons_call_to_action(54)
3:05.016 aoe q arcane_explosion Fluffy_Pillow 17964.0/63371: 28% mana arcane_charge(3), brons_call_to_action(55)
3:06.322 aoe r arcane_barrage Fluffy_Pillow 14619.2/63371: 23% mana arcane_charge(4), clearcasting, brons_call_to_action(56)
3:07.628 aoe q arcane_explosion Fluffy_Pillow 18809.3/63371: 30% mana clearcasting, brons_call_to_action(57)
3:08.934 aoe q arcane_explosion Fluffy_Pillow 20464.6/63371: 32% mana arcane_charge, brons_call_to_action(58)
3:10.239 aoe q arcane_explosion Fluffy_Pillow 17118.6/63371: 27% mana arcane_charge(2), brons_call_to_action(59)
3:11.548 aoe q arcane_explosion Fluffy_Pillow 13777.7/63371: 22% mana arcane_charge(3), brons_call_to_action(60)
3:12.855 aoe r arcane_barrage Fluffy_Pillow 10434.2/63371: 16% mana arcane_charge(4), brons_call_to_action(61)
3:14.161 aoe p arcane_orb Fluffy_Pillow 14624.3/63371: 23% mana brons_call_to_action(62)
3:15.467 aoe r arcane_barrage Fluffy_Pillow 15779.6/63371: 25% mana arcane_charge(4), brons_call_to_action(63)
3:16.774 aoe q arcane_explosion Fluffy_Pillow 19970.9/63371: 32% mana brons_call_to_action(64)
3:18.081 aoe j radiant_spark Fluffy_Pillow 16627.5/63371: 26% mana arcane_charge, brons_call_to_action(65)
3:19.389 aoe q arcane_explosion Fluffy_Pillow 17285.3/63371: 27% mana arcane_charge, brons_call_to_action(66)
3:20.697 aoe q arcane_explosion Fluffy_Pillow 13943.1/63371: 22% mana arcane_charge(2), brons_call_to_action(66)
3:22.004 aoe q arcane_explosion Fluffy_Pillow 10599.6/63371: 17% mana arcane_charge(3), clearcasting, brons_call_to_action(67)
3:23.311 aoe r arcane_barrage Fluffy_Pillow 12256.1/63371: 19% mana arcane_charge(4), brons_call_to_action(68)
3:24.616 aoe q arcane_explosion Fluffy_Pillow 16445.0/63371: 26% mana brons_call_to_action(69)
3:25.923 aoe q arcane_explosion Fluffy_Pillow 13101.5/63371: 21% mana arcane_charge, brons_call_to_action(70)
3:27.231 aoe q arcane_explosion Fluffy_Pillow 9759.3/63371: 15% mana arcane_charge(2), clearcasting, brons_call_to_action(71)
3:28.536 aoe q arcane_explosion Fluffy_Pillow 11413.3/63371: 18% mana arcane_charge(3), brons_call_to_action(72)
3:29.842 aoe r arcane_barrage Fluffy_Pillow 8068.6/63371: 13% mana arcane_charge(4), clearcasting, brons_call_to_action(73)
3:31.147 aoe q arcane_explosion Fluffy_Pillow 12257.4/63371: 19% mana clearcasting, brons_call_to_action(74)
3:32.454 aoe q arcane_explosion Fluffy_Pillow 13913.9/63371: 22% mana arcane_charge, brons_call_to_action(75)
3:33.761 aoe q arcane_explosion Fluffy_Pillow 10570.5/63371: 17% mana arcane_charge(2), clearcasting, brons_call_to_action(76)
3:35.067 aoe q arcane_explosion Fluffy_Pillow 12225.7/63371: 19% mana arcane_charge(3), brons_call_to_action(77)
3:36.373 aoe r arcane_barrage Fluffy_Pillow 8881.0/63371: 14% mana arcane_charge(4), clearcasting, brons_call_to_action(78)
3:37.680 aoe m touch_of_the_magi Fluffy_Pillow 13072.4/63371: 21% mana clearcasting, brons_call_to_action(79)
3:38.987 aoe o rune_of_power Fluffy_Pillow 12228.9/63371: 19% mana arcane_charge(4), clearcasting, brons_call_to_action(80)
3:40.292 aoe r arcane_barrage Fluffy_Pillow 13882.9/63371: 22% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(81)
3:41.599 aoe p arcane_orb Fluffy_Pillow 18074.3/63371: 29% mana clearcasting, rune_of_power, brons_call_to_action(81)
3:42.908 aoe r arcane_barrage Fluffy_Pillow 19233.4/63371: 30% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(82)
3:44.216 aoe q arcane_explosion Fluffy_Pillow 23426.0/63371: 37% mana clearcasting, rune_of_power, brons_call_to_action(83)
3:45.523 aoe q arcane_explosion Fluffy_Pillow 25082.5/63371: 40% mana arcane_charge, rune_of_power, brons_call_to_action(84)
3:46.830 aoe q arcane_explosion Fluffy_Pillow 21739.1/63371: 34% mana arcane_charge(2), rune_of_power, brons_call_to_action(85)
3:48.138 aoe q arcane_explosion Fluffy_Pillow 18396.9/63371: 29% mana arcane_charge(3), rune_of_power, brons_call_to_action(86)
3:49.444 aoe r arcane_barrage Fluffy_Pillow 15052.1/63371: 24% mana arcane_charge(4), rune_of_power, brons_call_to_action(87)
3:50.752 aoe j radiant_spark Fluffy_Pillow 19244.8/63371: 30% mana rune_of_power, brons_call_to_action(88)
3:52.058 aoe q arcane_explosion Fluffy_Pillow 19900.0/63371: 31% mana rune_of_power, brons_call_to_action(89)
3:53.365 aoe q arcane_explosion Fluffy_Pillow 16556.6/63371: 26% mana arcane_charge, clearcasting, brons_call_to_action(89)
3:54.671 aoe q arcane_explosion Fluffy_Pillow 18211.8/63371: 29% mana arcane_charge(2)
3:55.978 aoe q arcane_explosion Fluffy_Pillow 14868.4/63371: 23% mana arcane_charge(3), brons_call_to_action
3:57.285 aoe r arcane_barrage Fluffy_Pillow 11524.9/63371: 18% mana arcane_charge(4), clearcasting, brons_call_to_action(2)
3:58.592 aoe q arcane_explosion Fluffy_Pillow 15716.3/63371: 25% mana clearcasting, brons_call_to_action(3)
3:59.899 aoe q arcane_explosion Fluffy_Pillow 17372.8/63371: 27% mana arcane_charge, brons_call_to_action(4)
4:01.205 aoe q arcane_explosion Fluffy_Pillow 14028.1/63371: 22% mana arcane_charge(2), brons_call_to_action(5)
4:02.512 aoe q arcane_explosion Fluffy_Pillow 10684.6/63371: 17% mana arcane_charge(3), brons_call_to_action(6)
4:03.819 aoe r arcane_barrage Fluffy_Pillow 7341.1/63371: 12% mana arcane_charge(4), brons_call_to_action(7)
4:05.124 aoe p arcane_orb Fluffy_Pillow 11530.0/63371: 18% mana brons_call_to_action(8)
4:06.431 aoe r arcane_barrage Fluffy_Pillow 12686.5/63371: 20% mana arcane_charge(4), brons_call_to_action(9)
4:07.738 aoe q arcane_explosion Fluffy_Pillow 16877.9/63371: 27% mana brons_call_to_action(10)
4:09.044 aoe q arcane_explosion Fluffy_Pillow 13533.2/63371: 21% mana arcane_charge, brons_call_to_action(11)
4:10.351 aoe q arcane_explosion Fluffy_Pillow 10189.7/63371: 16% mana arcane_charge(2), brons_call_to_action(12)
4:11.655 aoe q arcane_explosion Fluffy_Pillow 6842.4/63371: 11% mana arcane_charge(3), clearcasting, brons_call_to_action(13)
4:12.960 aoe r arcane_barrage Fluffy_Pillow 8496.4/63371: 13% mana arcane_charge(4), brons_call_to_action(14)
4:14.266 aoe q arcane_explosion Fluffy_Pillow 12686.5/63371: 20% mana brons_call_to_action(15)
4:15.572 aoe q arcane_explosion Fluffy_Pillow 9341.8/63371: 15% mana arcane_charge, clearcasting, brons_call_to_action(16)
4:16.879 aoe q arcane_explosion Fluffy_Pillow 10998.3/63371: 17% mana arcane_charge(2), brons_call_to_action(17)
4:18.186 aoe q arcane_explosion Fluffy_Pillow 7654.8/63371: 12% mana arcane_charge(3), brons_call_to_action(18)
4:19.493 aoe r arcane_barrage Fluffy_Pillow 4311.4/63371: 7% mana arcane_charge(4), clearcasting, brons_call_to_action(19)
4:20.800 aoe q arcane_explosion Fluffy_Pillow 8502.8/63371: 13% mana clearcasting, brons_call_to_action(20)
4:22.106 aoe q arcane_explosion Fluffy_Pillow 10158.0/63371: 16% mana arcane_charge, brons_call_to_action(21)
4:23.414 aoe q arcane_explosion Fluffy_Pillow 6815.8/63371: 11% mana arcane_charge(2), brons_call_to_action(22)
4:24.721 shared_cds t use_mana_gem Kyrian_Forgelite 3472.3/63371: 5% mana arcane_charge(3), brons_call_to_action(23)
4:24.721 aoe q arcane_explosion Fluffy_Pillow 9809.5/63371: 15% mana arcane_charge(3), brons_call_to_action(23)
4:26.028 aoe r arcane_barrage Fluffy_Pillow 6466.0/63371: 10% mana arcane_charge(4), clearcasting, brons_call_to_action(24)
4:27.334 aoe k radiant_spark Fluffy_Pillow 10656.1/63371: 17% mana clearcasting, brons_call_to_action(25)
4:28.641 aoe m touch_of_the_magi Fluffy_Pillow 11312.7/63371: 18% mana clearcasting, brons_call_to_action(26)
4:29.946 aoe n arcane_power Fluffy_Pillow 10466.7/63371: 17% mana arcane_charge(4), clearcasting, brons_call_to_action(27)
4:29.946 shared_cds v berserking Fluffy_Pillow 10466.7/63371: 17% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(27)
4:29.946 aoe r arcane_barrage Fluffy_Pillow 10466.7/63371: 17% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(27)
4:31.135 aoe p arcane_orb Fluffy_Pillow 14508.5/63371: 23% mana berserking, arcane_power, clearcasting, rune_of_power, brons_call_to_action(27)
4:32.324 aoe r arcane_barrage Fluffy_Pillow 15765.5/63371: 25% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(28)
4:33.513 aoe q arcane_explosion Fluffy_Pillow 19807.3/63371: 31% mana berserking, arcane_power, clearcasting, rune_of_power, brons_call_to_action(29)
4:34.702 aoe q arcane_explosion Fluffy_Pillow 21314.3/63371: 34% mana berserking, arcane_charge, arcane_power, rune_of_power, brons_call_to_action(30)
4:35.890 aoe q arcane_explosion Fluffy_Pillow 20320.0/63371: 32% mana berserking, arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(31)
4:37.079 aoe q arcane_explosion Fluffy_Pillow 19326.9/63371: 30% mana berserking, arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(32)
4:38.267 aoe r arcane_barrage Fluffy_Pillow 18332.6/63371: 29% mana berserking, arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(33)
4:39.455 aoe q arcane_explosion Fluffy_Pillow 22373.2/63371: 35% mana berserking, arcane_power, rune_of_power, brons_call_to_action(34)
4:40.641 aoe q arcane_explosion Fluffy_Pillow 21376.4/63371: 34% mana berserking, arcane_charge, arcane_power, rune_of_power, brons_call_to_action(35)
4:41.827 aoe q arcane_explosion Fluffy_Pillow 20379.5/63371: 32% mana berserking, arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(36)
4:43.014 aoe q arcane_explosion Fluffy_Pillow 19384.0/63371: 31% mana arcane_charge(3), arcane_power, brons_call_to_action(37)
4:44.321 aoe o rune_of_power Fluffy_Pillow 18540.5/63371: 29% mana arcane_charge(4), arcane_power, brons_call_to_action(38)
4:45.627 aoe r arcane_barrage Fluffy_Pillow 20195.8/63371: 32% mana arcane_charge(4), rune_of_power, brons_call_to_action(39)
4:46.933 aoe q arcane_explosion Fluffy_Pillow 24385.9/63371: 38% mana rune_of_power, brons_call_to_action(39)
4:48.240 aoe q arcane_explosion Fluffy_Pillow 21042.4/63371: 33% mana arcane_charge, rune_of_power, brons_call_to_action(40)
4:49.548 aoe q arcane_explosion Fluffy_Pillow 17700.2/63371: 28% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(41)
4:50.854 aoe q arcane_explosion Fluffy_Pillow 19355.5/63371: 31% mana arcane_charge(3), rune_of_power, brons_call_to_action(42)
4:52.161 aoe r arcane_barrage Fluffy_Pillow 16012.0/63371: 25% mana arcane_charge(4), rune_of_power, brons_call_to_action(43)
4:53.469 aoe p arcane_orb Fluffy_Pillow 20204.7/63371: 32% mana rune_of_power, brons_call_to_action(44)
4:54.775 aoe r arcane_barrage Fluffy_Pillow 21359.9/63371: 34% mana arcane_charge(4), rune_of_power, brons_call_to_action(45)
4:56.083 aoe q arcane_explosion Fluffy_Pillow 25552.6/63371: 40% mana rune_of_power, brons_call_to_action(46)
4:57.389 aoe q arcane_explosion Fluffy_Pillow 22207.8/63371: 35% mana arcane_charge, rune_of_power, brons_call_to_action(47)
4:58.695 aoe j radiant_spark Fluffy_Pillow 18863.1/63371: 30% mana arcane_charge(2), clearcasting, brons_call_to_action(48)
5:00.002 aoe q arcane_explosion Fluffy_Pillow 19519.6/63371: 31% mana arcane_charge(2), clearcasting, brons_call_to_action(49)
5:01.308 aoe q arcane_explosion Fluffy_Pillow 21174.9/63371: 33% mana arcane_charge(3), brons_call_to_action(49)
5:02.616 aoe r arcane_barrage Fluffy_Pillow 17832.7/63371: 28% mana arcane_charge(4), brons_call_to_action(50)
5:03.923 aoe q arcane_explosion Fluffy_Pillow 22024.1/63371: 35% mana brons_call_to_action(51)
5:05.229 aoe q arcane_explosion Fluffy_Pillow 18679.3/63371: 29% mana arcane_charge, brons_call_to_action(52)
5:06.536 aoe q arcane_explosion Fluffy_Pillow 15335.9/63371: 24% mana arcane_charge(2), brons_call_to_action(53)
5:07.842 aoe q arcane_explosion Fluffy_Pillow 11991.1/63371: 19% mana arcane_charge(3), clearcasting, brons_call_to_action(54)
5:09.148 aoe r arcane_barrage Fluffy_Pillow 13646.4/63371: 22% mana arcane_charge(4), brons_call_to_action(55)
5:10.454 aoe q arcane_explosion Fluffy_Pillow 17836.5/63371: 28% mana brons_call_to_action(56)
5:11.762 aoe q arcane_explosion Fluffy_Pillow 14494.3/63371: 23% mana arcane_charge, brons_call_to_action(57)
5:13.070 aoe q arcane_explosion Fluffy_Pillow 11152.1/63371: 18% mana arcane_charge(2), brons_call_to_action(58)
5:14.377 aoe q arcane_explosion Fluffy_Pillow 7808.6/63371: 12% mana arcane_charge(3), brons_call_to_action(59)
5:15.685 aoe r arcane_barrage Fluffy_Pillow 4466.4/63371: 7% mana arcane_charge(4), clearcasting, brons_call_to_action(60)
5:16.993 aoe p arcane_orb Fluffy_Pillow 8659.1/63371: 14% mana clearcasting, brons_call_to_action(61)
5:18.300 aoe r arcane_barrage Fluffy_Pillow 9815.6/63371: 15% mana arcane_charge(4), clearcasting, brons_call_to_action(62)
5:19.608 aoe q arcane_explosion Fluffy_Pillow 14008.3/63371: 22% mana clearcasting, brons_call_to_action(63)
5:20.915 aoe q arcane_explosion Fluffy_Pillow 15664.8/63371: 25% mana arcane_charge, brons_call_to_action(64)
5:22.221 aoe q arcane_explosion Fluffy_Pillow 12320.1/63371: 19% mana arcane_charge(2), brons_call_to_action(65)
5:23.530 aoe q arcane_explosion Fluffy_Pillow 8979.1/63371: 14% mana arcane_charge(3), brons_call_to_action(66)
5:24.837 aoe r arcane_barrage Fluffy_Pillow 5635.7/63371: 9% mana arcane_charge(4), brons_call_to_action(67)
5:26.144 aoe q arcane_explosion Fluffy_Pillow 9827.0/63371: 16% mana brons_call_to_action(68)
5:27.451 aoe q arcane_explosion Fluffy_Pillow 6483.6/63371: 10% mana arcane_charge, brons_call_to_action(69)
5:28.757 aoe s evocation Kyrian_Forgelite 3138.8/63371: 5% mana arcane_charge(2), brons_call_to_action(70)
5:33.100 aoe k radiant_spark Fluffy_Pillow 56982.2/63371: 90% mana arcane_charge(2), brons_call_to_action(70)
5:34.408 aoe m touch_of_the_magi Fluffy_Pillow 57640.0/63371: 91% mana arcane_charge(2), brons_call_to_action(71)
5:35.714 aoe o rune_of_power Fluffy_Pillow 56795.3/63371: 90% mana arcane_charge(4), brons_call_to_action(72)
5:37.020 aoe r arcane_barrage Fluffy_Pillow 58450.5/63371: 92% mana arcane_charge(4), rune_of_power, brons_call_to_action(73)
5:38.327 aoe p arcane_orb Fluffy_Pillow 62641.9/63371: 99% mana rune_of_power, brons_call_to_action(73)
5:39.633 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power, brons_call_to_action(74)
5:40.939 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, brons_call_to_action(75)
5:42.244 aoe q arcane_explosion Fluffy_Pillow 60025.4/63371: 95% mana arcane_charge, clearcasting, rune_of_power, brons_call_to_action(76)
5:43.551 aoe q arcane_explosion Fluffy_Pillow 61682.0/63371: 97% mana arcane_charge(2), rune_of_power, brons_call_to_action(77)
5:44.858 aoe q arcane_explosion Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(3), rune_of_power, brons_call_to_action(78)
5:46.165 aoe r arcane_barrage Fluffy_Pillow 54995.0/63371: 87% mana arcane_charge(4), rune_of_power, brons_call_to_action(79)
5:47.471 aoe q arcane_explosion Fluffy_Pillow 59185.1/63371: 93% mana rune_of_power, brons_call_to_action(80)
5:48.776 aoe q arcane_explosion Fluffy_Pillow 55839.1/63371: 88% mana arcane_charge, rune_of_power, brons_call_to_action(81)
5:50.082 aoe q arcane_explosion Fluffy_Pillow 52494.4/63371: 83% mana arcane_charge(2), clearcasting, brons_call_to_action(82)
5:51.387 aoe q arcane_explosion Fluffy_Pillow 54148.4/63371: 85% mana arcane_charge(3), brons_call_to_action(83)
5:52.694 aoe r arcane_barrage Fluffy_Pillow 50804.9/63371: 80% mana arcane_charge(4), brons_call_to_action(84)
5:54.001 aoe q arcane_explosion Fluffy_Pillow 54996.3/63371: 87% mana brons_call_to_action(85)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Forgelite"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=333950//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Kyrian_Pelagos : 10910 dps, 4852 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10910.3 10910.3 16.3 / 0.150% 1133.0 / 10.4% 5.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
1995.0 1903.3 Mana 0.00% 49.5 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 10910
Arcane Barrage 3942 36.2% 55.4 5.41sec 21366 17142 Direct 166.1 5974 11992 7131 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.43 166.09 0.00 0.00 1.2464 0.0000 1184342.51 1184342.51 0.00% 17141.78 17141.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 134.13 92 172 5974.24 2082 31635 5963.31 5272 6566 801031 801031 0.00%
crit 19.24% 31.96 13 57 11992.15 4164 63270 11975.53 7474 19485 383311 383311 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.43
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 373 3.4% 59.5 4.67sec 1881 0 Direct 178.6 526 1053 627 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.54 178.62 0.00 0.00 0.0000 0.0000 111992.76 111992.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 144.36 106 190 525.96 316 664 525.42 487 574 75929 75929 0.00%
crit 19.18% 34.25 16 60 1052.73 633 1329 1052.41 912 1205 36064 36064 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4520 41.4% 148.8 1.98sec 9114 7335 Direct 446.4 2547 5097 3039 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.79 446.37 0.00 0.00 1.2426 0.0000 1356139.35 1356139.35 0.00% 7335.20 7335.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 360.22 273 452 2546.50 1958 6227 2545.75 2430 2670 917106 917106 0.00%
crit 19.30% 86.16 47 125 5096.81 3916 12454 5096.02 4473 5729 439034 439034 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:148.78
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (860) 0.0% (7.9%) 12.8 24.15sec 20134 16158

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.81 0.00 0.00 0.00 1.2460 0.0000 0.00 0.00 0.00% 16158.35 16158.35

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.82
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 860 7.9% 38.4 24.15sec 6722 0 Direct 38.4 5635 11285 6721 19.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.38 38.38 0.00 0.00 0.0000 0.0000 258000.45 258000.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 31.00 20 44 5635.37 3869 9669 5634.63 4961 6233 174698 174698 0.00%
crit 19.23% 7.38 0 19 11284.77 7739 19338 11272.00 0 17580 83302 83302 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.6%) 14.7 1.76sec 1392 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.68 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.6% 14.7 1.76sec 1392 0 Direct 14.7 1164 2327 1392 19.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.68 14.68 0.00 0.00 0.0000 0.0000 20438.76 20438.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.38% 11.80 5 19 1163.53 1164 1164 1163.53 1164 1164 13733 13733 0.00%
crit 19.62% 2.88 0 10 2327.06 2327 2327 2229.54 0 2327 6706 6706 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1764 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1765.38 1765.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 0.81 0 1 1480.68 1481 1481 1195.98 0 1481 1196 1196 0.00%
crit 19.23% 0.19 0 1 2961.35 2961 2961 569.40 0 2961 569 569 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5797 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.2% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5797.14 5797.14 0.00% 49.22 49.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 72.51 59 82 53.93 43 60 53.93 52 56 3910 3910 0.00%
crit 19.43% 17.49 8 31 107.87 86 120 107.89 94 120 1887 1887 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 182 1.7% 9.3 33.65sec 5846 4590 Direct 9.3 2850 5683 3400 19.4%
Periodic 60.6 316 630 377 19.4% 10.2%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.33 9.33 60.64 60.64 1.2737 1.5133 54538.78 54538.78 0.00% 526.21 4590.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 7.52 2 11 2850.13 2693 5655 2853.87 2693 4174 21436 21436 0.00%
crit 19.36% 1.81 0 6 5682.60 5386 11310 4874.06 0 11310 10260 10260 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 48.89 33 67 315.89 34 501 315.62 285 352 15441 15441 0.00%
crit 19.38% 11.75 3 25 629.90 68 1003 629.66 370 904 7401 7401 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.54
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.83
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:1.00
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (938) 0.0% (8.6%) 5.9 54.15sec 47313 37669

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 0.00 0.00 0.00 1.2560 0.0000 0.00 0.00 0.00% 37669.01 37669.01

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.98
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 938 8.6% 5.9 54.07sec 47313 0 Direct 17.8 15783 0 15783 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 17.82 0.00 0.00 0.0000 0.0000 281274.49 281274.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 17.82 15 21 15783.20 109 60219 15784.80 11843 19675 281274 281274 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24006.03
  • base_dd_max:24006.03
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Kyrian_Pelagos
Arcane Power 2.8 132.24sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.77
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 263.87sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.77
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.9 165.41sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.93 0.00 5.53 0.00 4.2883 0.7216 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:0.93
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 52.00sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.83 0.00 0.00 0.00 1.2550 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.85
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.45sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.2 149.8 5.3sec 1.4sec 3.9sec 72.11% 0.00% 0.1 (0.2) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.81%
  • arcane_charge_2:15.94%
  • arcane_charge_3:15.96%
  • arcane_charge_4:21.40%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 132.0sec 132.0sec 14.7sec 13.51% 0.00% 0.0 (0.0) 2.6

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.51%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 263.5sec 263.5sec 11.7sec 6.81% 23.08% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.0s / 272.1s
  • trigger_min/max:241.0s / 272.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:6.81%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 23.8 0.2 12.2sec 12.1sec 2.1sec 16.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.11%
  • clearcasting_2:0.22%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Combat Meditation 4.9 0.0 67.5sec 67.5sec 7.9sec 12.90% 0.00% 9.7 (9.7) 4.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:0.50
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:62.7s / 85.0s
  • trigger_min/max:62.7s / 85.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • combat_meditation_1:12.90%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 0.9 0.0 175.0sec 175.0sec 4.3sec 1.34% 0.00% 3.7 (3.7) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:118.0s / 242.1s
  • trigger_min/max:118.0s / 242.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.34%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.2sec 36.2sec 11.8sec 33.82% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 55.3s
  • trigger_min/max:15.7s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:33.82%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.46% 0.83% 6.30% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.091120.122239.871
Evocation176.79328.004356.153232.675142.450359.851
Rune of Power7.9971.13724.68948.15131.83675.290
Touch of the Magi6.9091.13723.39242.82230.52975.290
Arcane Power8.4960.36618.90124.2192.72234.465
Arcane Barrage2.9160.0029.586162.831129.832198.362
Arcane Orb4.0540.01811.79152.31040.12268.754
Radiant Spark2.2230.00025.19721.1859.70158.625

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
mana_regen Mana 626.26 372729.10 65.26% 595.17 11650.43 3.03%
Evocation Mana 44.28 44618.06 7.81% 1007.64 0.00 0.00%
Mana Gem Mana 2.74 17790.44 3.11% 6485.99 0.00 0.00%
Arcane Barrage Mana 55.43 135996.14 23.81% 2453.34 6806.13 4.77%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1903.28 1994.97 18405.0 34825.5 633.8 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
arcane_explosion Mana 148.8 567767.6 3816.1 3815.9 2.4
arcane_orb Mana 12.8 5732.8 447.3 447.4 45.0
radiant_spark Mana 9.3 9214.9 987.8 987.8 5.9
touch_of_the_magi Mana 5.9 14864.2 2500.0 2500.3 18.9

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Kyrian_Pelagos Damage Per Second
Count 1217
Mean 10910.27
Minimum 9953.12
Maximum 11805.46
Spread ( max - min ) 1852.34
Range [ ( max - min ) / 2 * 100% ] 8.49%
Standard Deviation 290.5134
5th Percentile 10426.71
95th Percentile 11391.45
( 95th Percentile - 5th Percentile ) 964.73
Mean Distribution
Standard Deviation 8.3276
95.00% Confidence Interval ( 10893.95 - 10926.60 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2724
0.1 Scale Factor Error with Delta=300 721
0.05 Scale Factor Error with Delta=300 2882
0.01 Scale Factor Error with Delta=300 72048
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 1217
Mean 4852.04
Minimum 4326.34
Maximum 5449.26
Spread ( max - min ) 1122.92
Range [ ( max - min ) / 2 * 100% ] 11.57%
Standard Deviation 177.7236
5th Percentile 4562.90
95th Percentile 5143.03
( 95th Percentile - 5th Percentile ) 580.13
Mean Distribution
Standard Deviation 5.0945
95.00% Confidence Interval ( 4842.05 - 4862.02 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5154
0.1 Scale Factor Error with Delta=300 270
0.05 Scale Factor Error with Delta=300 1079
0.01 Scale Factor Error with Delta=300 26964
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 1217
Mean 10910.27
Minimum 9953.12
Maximum 11805.46
Spread ( max - min ) 1852.34
Range [ ( max - min ) / 2 * 100% ] 8.49%
Damage
Kyrian_Pelagos Damage
Count 1217
Mean 3268492.47
Minimum 2455330.78
Maximum 4010646.17
Spread ( max - min ) 1555315.39
Range [ ( max - min ) / 2 * 100% ] 23.79%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.54 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.83 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 1.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.98 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.77 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.85 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.82 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 148.78 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.43 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 0.93 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.77 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqtqrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqtrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqsqrjprqqqqrqqqqrmorqqqqrprqjqqqrqqqqrqqqqrprqqqqrqqqqtrkmnvrqqqqrprqqqqorqqqqrqqqqrjprqqqqrqqqqrqqqqrprqqqsqrkmorqqqqrprqqqqr

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe m touch_of_the_magi Fluffy_Pillow 68283.7/69371: 98% mana bloodlust, combat_meditation
0:02.314 aoe n arcane_power Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, arcane_charge(4), combat_meditation
0:02.314 shared_cds u potion Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
0:02.314 shared_cds v berserking Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:02.314 aoe r arcane_barrage Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:03.228 aoe p arcane_orb Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:04.143 aoe r arcane_barrage Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.059 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.973 aoe q arcane_explosion Fluffy_Pillow 68139.5/69371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:06.887 aoe q arcane_explosion Fluffy_Pillow 66907.6/69371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:07.802 aoe q arcane_explosion Fluffy_Pillow 65677.1/69371: 95% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:08.717 aoe r arcane_barrage Fluffy_Pillow 64446.6/69371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:09.632 aoe q arcane_explosion Fluffy_Pillow 62567.1/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.547 aoe q arcane_explosion Fluffy_Pillow 61226.8/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.461 aoe q arcane_explosion Fluffy_Pillow 59885.3/63371: 94% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.374 aoe q arcane_explosion Fluffy_Pillow 58542.4/63371: 92% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:13.290 aoe r arcane_barrage Fluffy_Pillow 59703.4/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.206 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.121 aoe q arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:16.127 aoe q arcane_explosion Fluffy_Pillow 60806.2/63371: 96% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, potion_of_deathly_fixation
0:17.133 aoe q arcane_explosion Fluffy_Pillow 62081.2/63371: 98% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:18.140 aoe o rune_of_power Fluffy_Pillow 60857.5/63371: 96% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.147 aoe r arcane_barrage Fluffy_Pillow 62133.8/63371: 98% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.153 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.159 aoe q arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.166 aoe q arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.170 shared_cds t use_mana_gem Kyrian_Pelagos 52195.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.170 aoe q arcane_explosion Fluffy_Pillow 58532.4/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.176 aoe r arcane_barrage Fluffy_Pillow 54807.4/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.181 aoe p arcane_orb Fluffy_Pillow 58616.1/63371: 92% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.187 aoe r arcane_barrage Fluffy_Pillow 59391.1/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.193 aoe q arcane_explosion Fluffy_Pillow 63201.0/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.200 aoe q arcane_explosion Fluffy_Pillow 59477.3/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.205 aoe q arcane_explosion Fluffy_Pillow 55751.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.210 aoe q arcane_explosion Fluffy_Pillow 52024.8/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.216 aoe r arcane_barrage Fluffy_Pillow 48299.8/63371: 76% mana bloodlust, arcane_charge(4), clearcasting
0:32.222 aoe j radiant_spark Fluffy_Pillow 52109.7/63371: 82% mana bloodlust, clearcasting
0:33.228 aoe q arcane_explosion Fluffy_Pillow 52384.8/63371: 83% mana bloodlust, clearcasting
0:34.233 aoe q arcane_explosion Fluffy_Pillow 53658.5/63371: 85% mana bloodlust, arcane_charge
0:35.238 aoe q arcane_explosion Fluffy_Pillow 49932.3/63371: 79% mana bloodlust, arcane_charge(2)
0:36.244 aoe q arcane_explosion Fluffy_Pillow 46207.3/63371: 73% mana bloodlust, arcane_charge(3)
0:37.249 aoe r arcane_barrage Fluffy_Pillow 42481.1/63371: 67% mana bloodlust, arcane_charge(4)
0:38.255 aoe q arcane_explosion Fluffy_Pillow 46291.0/63371: 73% mana bloodlust
0:39.262 aoe q arcane_explosion Fluffy_Pillow 42567.3/63371: 67% mana bloodlust, arcane_charge
0:40.269 aoe q arcane_explosion Fluffy_Pillow 38843.6/63371: 61% mana bloodlust, arcane_charge(2)
0:41.275 aoe q arcane_explosion Fluffy_Pillow 35118.6/63371: 55% mana arcane_charge(3)
0:42.583 aoe r arcane_barrage Fluffy_Pillow 31776.4/63371: 50% mana arcane_charge(4)
0:43.890 aoe q arcane_explosion Fluffy_Pillow 35967.8/63371: 57% mana
0:45.197 aoe q arcane_explosion Fluffy_Pillow 32624.3/63371: 51% mana arcane_charge
0:46.504 aoe q arcane_explosion Fluffy_Pillow 29280.9/63371: 46% mana arcane_charge(2)
0:47.812 aoe q arcane_explosion Fluffy_Pillow 25938.7/63371: 41% mana arcane_charge(3)
0:49.118 aoe r arcane_barrage Fluffy_Pillow 22593.9/63371: 36% mana arcane_charge(4)
0:50.425 aoe p arcane_orb Fluffy_Pillow 26785.3/63371: 42% mana
0:51.732 aoe r arcane_barrage Fluffy_Pillow 27941.8/63371: 44% mana arcane_charge(4)
0:53.038 aoe q arcane_explosion Fluffy_Pillow 32132.0/63371: 51% mana
0:54.343 aoe q arcane_explosion Fluffy_Pillow 28786.0/63371: 45% mana arcane_charge
0:55.648 aoe q arcane_explosion Fluffy_Pillow 25439.9/63371: 40% mana arcane_charge(2)
0:56.955 aoe q arcane_explosion Fluffy_Pillow 22096.5/63371: 35% mana arcane_charge(3)
0:58.261 aoe r arcane_barrage Fluffy_Pillow 18751.7/63371: 30% mana arcane_charge(4), clearcasting
0:59.569 aoe q arcane_explosion Fluffy_Pillow 22944.4/63371: 36% mana clearcasting
1:00.876 aoe q arcane_explosion Fluffy_Pillow 24600.9/63371: 39% mana arcane_charge
1:02.184 aoe q arcane_explosion Fluffy_Pillow 21258.7/63371: 34% mana arcane_charge(2), clearcasting
1:03.491 aoe q arcane_explosion Fluffy_Pillow 22915.2/63371: 36% mana arcane_charge(3)
1:04.797 aoe r arcane_barrage Fluffy_Pillow 19570.5/63371: 31% mana arcane_charge(4)
1:06.105 aoe k radiant_spark Fluffy_Pillow 23763.2/63371: 37% mana
1:07.411 aoe m touch_of_the_magi Fluffy_Pillow 26730.4/69371: 39% mana combat_meditation
1:08.718 aoe o rune_of_power Fluffy_Pillow 26043.7/69371: 38% mana arcane_charge(4), combat_meditation
1:10.025 aoe r arcane_barrage Fluffy_Pillow 27857.1/69371: 40% mana arcane_charge(4), rune_of_power, combat_meditation
1:11.331 aoe p arcane_orb Fluffy_Pillow 32443.9/69371: 47% mana rune_of_power, combat_meditation
1:12.638 aoe r arcane_barrage Fluffy_Pillow 33757.3/69371: 49% mana arcane_charge(4), rune_of_power, combat_meditation
1:13.945 aoe q arcane_explosion Fluffy_Pillow 38345.5/69371: 55% mana rune_of_power, combat_meditation
1:15.252 aoe q arcane_explosion Fluffy_Pillow 35158.9/69371: 51% mana arcane_charge, clearcasting, rune_of_power, combat_meditation
1:16.558 aoe q arcane_explosion Fluffy_Pillow 33773.2/63371: 53% mana arcane_charge(2), rune_of_power
1:17.866 aoe q arcane_explosion Fluffy_Pillow 30431.0/63371: 48% mana arcane_charge(3), clearcasting, rune_of_power
1:19.173 aoe r arcane_barrage Fluffy_Pillow 32087.6/63371: 51% mana arcane_charge(4), rune_of_power
1:20.479 aoe q arcane_explosion Fluffy_Pillow 36277.7/63371: 57% mana rune_of_power
1:21.785 aoe q arcane_explosion Fluffy_Pillow 32932.9/63371: 52% mana arcane_charge, clearcasting, rune_of_power
1:23.091 aoe q arcane_explosion Fluffy_Pillow 34588.2/63371: 55% mana arcane_charge(2)
1:24.398 aoe q arcane_explosion Fluffy_Pillow 31244.7/63371: 49% mana arcane_charge(3)
1:25.706 aoe r arcane_barrage Fluffy_Pillow 27902.5/63371: 44% mana arcane_charge(4), clearcasting
1:27.011 aoe q arcane_explosion Fluffy_Pillow 32091.4/63371: 51% mana clearcasting
1:28.318 aoe q arcane_explosion Fluffy_Pillow 33747.9/63371: 53% mana arcane_charge
1:29.625 aoe q arcane_explosion Fluffy_Pillow 30404.4/63371: 48% mana arcane_charge(2)
1:30.932 aoe q arcane_explosion Fluffy_Pillow 27061.0/63371: 43% mana arcane_charge(3)
1:32.239 aoe r arcane_barrage Fluffy_Pillow 23717.5/63371: 37% mana arcane_charge(4)
1:33.546 aoe p arcane_orb Fluffy_Pillow 27908.9/63371: 44% mana
1:34.852 aoe r arcane_barrage Fluffy_Pillow 29064.1/63371: 46% mana arcane_charge(4)
1:36.159 aoe q arcane_explosion Fluffy_Pillow 33255.5/63371: 52% mana
1:37.465 aoe j radiant_spark Fluffy_Pillow 29910.8/63371: 47% mana arcane_charge
1:38.772 aoe q arcane_explosion Fluffy_Pillow 30567.3/63371: 48% mana arcane_charge
1:40.078 aoe q arcane_explosion Fluffy_Pillow 27222.6/63371: 43% mana arcane_charge(2)
1:41.384 aoe q arcane_explosion Fluffy_Pillow 23877.8/63371: 38% mana arcane_charge(3)
1:42.691 aoe r arcane_barrage Fluffy_Pillow 20534.4/63371: 32% mana arcane_charge(4)
1:43.998 aoe q arcane_explosion Fluffy_Pillow 24725.8/63371: 39% mana
1:45.304 aoe q arcane_explosion Fluffy_Pillow 21381.0/63371: 34% mana arcane_charge
1:46.612 aoe q arcane_explosion Fluffy_Pillow 18038.8/63371: 28% mana arcane_charge(2)
1:47.918 aoe q arcane_explosion Fluffy_Pillow 14694.1/63371: 23% mana arcane_charge(3), clearcasting
1:49.224 aoe r arcane_barrage Fluffy_Pillow 16349.3/63371: 26% mana arcane_charge(4)
1:50.531 aoe q arcane_explosion Fluffy_Pillow 20540.7/63371: 32% mana
1:51.836 aoe q arcane_explosion Fluffy_Pillow 17194.7/63371: 27% mana arcane_charge
1:53.142 aoe q arcane_explosion Fluffy_Pillow 13850.0/63371: 22% mana arcane_charge(2)
1:54.448 aoe q arcane_explosion Fluffy_Pillow 10505.2/63371: 17% mana arcane_charge(3)
1:55.755 aoe r arcane_barrage Fluffy_Pillow 7161.8/63371: 11% mana arcane_charge(4)
1:57.061 aoe m touch_of_the_magi Fluffy_Pillow 11351.9/63371: 18% mana
1:58.367 aoe o rune_of_power Fluffy_Pillow 10507.2/63371: 17% mana arcane_charge(4), clearcasting
1:59.674 aoe r arcane_barrage Fluffy_Pillow 12163.7/63371: 19% mana arcane_charge(4), clearcasting, rune_of_power
2:00.982 aoe p arcane_orb Fluffy_Pillow 16356.3/63371: 26% mana clearcasting, rune_of_power
2:02.288 aoe r arcane_barrage Fluffy_Pillow 17511.6/63371: 28% mana arcane_charge(4), clearcasting, rune_of_power
2:03.597 aoe q arcane_explosion Fluffy_Pillow 21705.5/63371: 34% mana clearcasting, rune_of_power
2:04.903 aoe q arcane_explosion Fluffy_Pillow 23360.8/63371: 37% mana arcane_charge, rune_of_power
2:06.209 aoe q arcane_explosion Fluffy_Pillow 20016.0/63371: 32% mana arcane_charge(2), rune_of_power
2:07.515 aoe q arcane_explosion Fluffy_Pillow 16671.3/63371: 26% mana arcane_charge(3), rune_of_power
2:08.822 aoe r arcane_barrage Fluffy_Pillow 13327.8/63371: 21% mana arcane_charge(4), rune_of_power
2:10.130 aoe q arcane_explosion Fluffy_Pillow 17520.5/63371: 28% mana rune_of_power
2:11.437 aoe q arcane_explosion Fluffy_Pillow 14177.0/63371: 22% mana arcane_charge, rune_of_power
2:12.742 aoe q arcane_explosion Fluffy_Pillow 10831.0/63371: 17% mana arcane_charge(2)
2:14.049 aoe q arcane_explosion Fluffy_Pillow 7487.5/63371: 12% mana arcane_charge(3)
2:15.356 aoe l radiant_spark Fluffy_Pillow 4144.1/63371: 7% mana arcane_charge(4)
2:16.662 aoe n arcane_power Fluffy_Pillow 5253.7/69371: 8% mana arcane_charge(4), clearcasting, combat_meditation
2:16.662 aoe r arcane_barrage Fluffy_Pillow 5253.7/69371: 8% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, combat_meditation
2:17.970 aoe q arcane_explosion Fluffy_Pillow 9843.3/69371: 14% mana arcane_power, clearcasting, rune_of_power, combat_meditation
2:19.275 aoe q arcane_explosion Fluffy_Pillow 11653.9/69371: 17% mana arcane_charge, arcane_power, rune_of_power, combat_meditation
2:20.579 aoe q arcane_explosion Fluffy_Pillow 10963.1/69371: 16% mana arcane_charge(2), arcane_power, rune_of_power, combat_meditation
2:21.885 aoe q arcane_explosion Fluffy_Pillow 10275.1/69371: 15% mana arcane_charge(3), arcane_power, rune_of_power, combat_meditation
2:23.192 shared_cds t use_mana_gem Kyrian_Pelagos 9588.5/69371: 14% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:23.192 aoe r arcane_barrage Fluffy_Pillow 16525.6/69371: 24% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:24.497 aoe p arcane_orb Fluffy_Pillow 21111.1/69371: 30% mana arcane_power, rune_of_power, combat_meditation
2:25.805 aoe r arcane_barrage Fluffy_Pillow 20714.6/63371: 33% mana arcane_charge(4), arcane_power, rune_of_power
2:27.111 aoe q arcane_explosion Fluffy_Pillow 24904.7/63371: 39% mana arcane_power, rune_of_power
2:28.418 aoe q arcane_explosion Fluffy_Pillow 24061.2/63371: 38% mana arcane_charge, arcane_power, clearcasting, rune_of_power
2:29.724 aoe q arcane_explosion Fluffy_Pillow 25716.5/63371: 41% mana arcane_charge(2), arcane_power
2:31.031 aoe q arcane_explosion Fluffy_Pillow 24873.0/63371: 39% mana arcane_charge(3), arcane_power
2:32.339 aoe r arcane_barrage Fluffy_Pillow 24030.8/63371: 38% mana arcane_charge(4)
2:33.646 aoe q arcane_explosion Fluffy_Pillow 28222.2/63371: 45% mana
2:34.951 aoe q arcane_explosion Fluffy_Pillow 24876.2/63371: 39% mana arcane_charge
2:36.257 aoe q arcane_explosion Fluffy_Pillow 21531.5/63371: 34% mana arcane_charge(2)
2:37.565 aoe q arcane_explosion Fluffy_Pillow 18189.3/63371: 29% mana arcane_charge(3)
2:38.871 aoe r arcane_barrage Fluffy_Pillow 14844.5/63371: 23% mana arcane_charge(4), clearcasting
2:40.177 aoe q arcane_explosion Fluffy_Pillow 19034.7/63371: 30% mana clearcasting
2:41.483 aoe q arcane_explosion Fluffy_Pillow 20689.9/63371: 33% mana arcane_charge
2:42.790 aoe q arcane_explosion Fluffy_Pillow 17346.4/63371: 27% mana arcane_charge(2)
2:44.095 aoe q arcane_explosion Fluffy_Pillow 14000.4/63371: 22% mana arcane_charge(3)
2:45.401 aoe r arcane_barrage Fluffy_Pillow 10655.7/63371: 17% mana arcane_charge(4)
2:46.708 aoe k radiant_spark Fluffy_Pillow 14847.1/63371: 23% mana
2:48.014 aoe m touch_of_the_magi Fluffy_Pillow 15502.3/63371: 24% mana
2:49.321 aoe o rune_of_power Fluffy_Pillow 14658.9/63371: 23% mana arcane_charge(4)
2:50.628 aoe r arcane_barrage Fluffy_Pillow 16315.4/63371: 26% mana arcane_charge(4), rune_of_power
2:51.936 aoe p arcane_orb Fluffy_Pillow 20508.1/63371: 32% mana rune_of_power
2:53.241 aoe r arcane_barrage Fluffy_Pillow 21662.1/63371: 34% mana arcane_charge(4), rune_of_power
2:54.547 aoe q arcane_explosion Fluffy_Pillow 25852.2/63371: 41% mana rune_of_power
2:55.855 aoe q arcane_explosion Fluffy_Pillow 22510.0/63371: 36% mana arcane_charge, rune_of_power
2:57.162 aoe q arcane_explosion Fluffy_Pillow 19166.5/63371: 30% mana arcane_charge(2), rune_of_power
2:58.469 aoe q arcane_explosion Fluffy_Pillow 15823.0/63371: 25% mana arcane_charge(3), rune_of_power
2:59.776 aoe r arcane_barrage Fluffy_Pillow 12479.6/63371: 20% mana arcane_charge(4), rune_of_power
3:01.081 aoe q arcane_explosion Fluffy_Pillow 16668.4/63371: 26% mana rune_of_power
3:02.388 aoe q arcane_explosion Fluffy_Pillow 13324.9/63371: 21% mana arcane_charge, rune_of_power
3:03.695 aoe q arcane_explosion Fluffy_Pillow 9981.5/63371: 16% mana arcane_charge(2)
3:05.002 aoe q arcane_explosion Fluffy_Pillow 6638.0/63371: 10% mana arcane_charge(3), clearcasting
3:06.308 aoe r arcane_barrage Fluffy_Pillow 8293.3/63371: 13% mana arcane_charge(4)
3:07.615 aoe q arcane_explosion Fluffy_Pillow 12484.6/63371: 20% mana
3:08.921 aoe q arcane_explosion Fluffy_Pillow 9139.9/63371: 14% mana arcane_charge
3:10.229 aoe q arcane_explosion Fluffy_Pillow 5797.7/63371: 9% mana arcane_charge(2)
3:11.536 aoe s evocation Kyrian_Pelagos 2454.2/63371: 4% mana arcane_charge(3)
3:15.879 aoe q arcane_explosion Fluffy_Pillow 56297.6/63371: 89% mana arcane_charge(3)
3:17.186 aoe r arcane_barrage Fluffy_Pillow 52954.2/63371: 84% mana arcane_charge(4)
3:18.493 aoe j radiant_spark Fluffy_Pillow 57145.5/63371: 90% mana
3:19.800 aoe p arcane_orb Fluffy_Pillow 63274.8/69371: 91% mana combat_meditation
3:21.108 aoe r arcane_barrage Fluffy_Pillow 64589.5/69371: 93% mana arcane_charge(4), combat_meditation
3:22.414 aoe q arcane_explosion Fluffy_Pillow 69176.4/69371: 100% mana combat_meditation
3:23.720 aoe q arcane_explosion Fluffy_Pillow 65988.3/69371: 95% mana arcane_charge, combat_meditation
3:25.024 aoe q arcane_explosion Fluffy_Pillow 62797.6/69371: 91% mana arcane_charge(2), combat_meditation
3:26.330 aoe q arcane_explosion Fluffy_Pillow 59609.5/69371: 86% mana arcane_charge(3), combat_meditation
3:27.636 aoe r arcane_barrage Fluffy_Pillow 56421.5/69371: 81% mana arcane_charge(4), combat_meditation
3:28.944 aoe q arcane_explosion Fluffy_Pillow 55734.2/63371: 88% mana
3:30.250 aoe q arcane_explosion Fluffy_Pillow 52389.5/63371: 83% mana arcane_charge
3:31.556 aoe q arcane_explosion Fluffy_Pillow 49044.7/63371: 77% mana arcane_charge(2)
3:32.863 aoe q arcane_explosion Fluffy_Pillow 45701.3/63371: 72% mana arcane_charge(3)
3:34.169 aoe r arcane_barrage Fluffy_Pillow 42356.5/63371: 67% mana arcane_charge(4)
3:35.475 aoe m touch_of_the_magi Fluffy_Pillow 46546.7/63371: 73% mana
3:36.783 aoe o rune_of_power Fluffy_Pillow 45704.4/63371: 72% mana arcane_charge(4)
3:38.091 aoe r arcane_barrage Fluffy_Pillow 47362.2/63371: 75% mana arcane_charge(4), rune_of_power
3:39.397 aoe q arcane_explosion Fluffy_Pillow 51552.4/63371: 81% mana rune_of_power
3:40.703 aoe q arcane_explosion Fluffy_Pillow 48207.6/63371: 76% mana arcane_charge, rune_of_power
3:42.009 aoe q arcane_explosion Fluffy_Pillow 44862.9/63371: 71% mana arcane_charge(2), rune_of_power
3:43.314 aoe q arcane_explosion Fluffy_Pillow 41516.9/63371: 66% mana arcane_charge(3), rune_of_power
3:44.620 aoe r arcane_barrage Fluffy_Pillow 38172.1/63371: 60% mana arcane_charge(4), clearcasting, rune_of_power
3:45.926 aoe p arcane_orb Fluffy_Pillow 42362.3/63371: 67% mana clearcasting, rune_of_power
3:47.232 aoe r arcane_barrage Fluffy_Pillow 43517.5/63371: 69% mana arcane_charge(4), clearcasting, rune_of_power
3:48.539 aoe q arcane_explosion Fluffy_Pillow 47708.9/63371: 75% mana clearcasting, rune_of_power
3:49.846 aoe j radiant_spark Fluffy_Pillow 49365.4/63371: 78% mana arcane_charge, rune_of_power
3:51.153 aoe q arcane_explosion Fluffy_Pillow 50022.0/63371: 79% mana arcane_charge
3:52.459 aoe q arcane_explosion Fluffy_Pillow 46677.2/63371: 74% mana arcane_charge(2)
3:53.765 aoe q arcane_explosion Fluffy_Pillow 43332.5/63371: 68% mana arcane_charge(3), clearcasting
3:55.072 aoe r arcane_barrage Fluffy_Pillow 44989.0/63371: 71% mana arcane_charge(4)
3:56.376 aoe q arcane_explosion Fluffy_Pillow 49176.6/63371: 78% mana
3:57.683 aoe q arcane_explosion Fluffy_Pillow 45833.1/63371: 72% mana arcane_charge
3:58.989 aoe q arcane_explosion Fluffy_Pillow 42488.4/63371: 67% mana arcane_charge(2)
4:00.296 aoe q arcane_explosion Fluffy_Pillow 39144.9/63371: 62% mana arcane_charge(3)
4:01.601 aoe r arcane_barrage Fluffy_Pillow 35798.9/63371: 56% mana arcane_charge(4)
4:02.907 aoe q arcane_explosion Fluffy_Pillow 39989.0/63371: 63% mana
4:04.214 aoe q arcane_explosion Fluffy_Pillow 36645.6/63371: 58% mana arcane_charge
4:05.520 aoe q arcane_explosion Fluffy_Pillow 33300.8/63371: 53% mana arcane_charge(2)
4:06.827 aoe q arcane_explosion Fluffy_Pillow 29957.4/63371: 47% mana arcane_charge(3)
4:08.134 aoe r arcane_barrage Fluffy_Pillow 26613.9/63371: 42% mana arcane_charge(4)
4:09.440 aoe p arcane_orb Fluffy_Pillow 30804.0/63371: 49% mana
4:10.747 aoe r arcane_barrage Fluffy_Pillow 31960.5/63371: 50% mana arcane_charge(4)
4:12.051 aoe q arcane_explosion Fluffy_Pillow 36148.1/63371: 57% mana
4:13.356 aoe q arcane_explosion Fluffy_Pillow 32802.1/63371: 52% mana arcane_charge
4:14.664 aoe q arcane_explosion Fluffy_Pillow 29459.9/63371: 46% mana arcane_charge(2), clearcasting
4:15.970 aoe q arcane_explosion Fluffy_Pillow 31115.2/63371: 49% mana arcane_charge(3)
4:17.276 aoe r arcane_barrage Fluffy_Pillow 27770.4/63371: 44% mana arcane_charge(4)
4:18.582 aoe q arcane_explosion Fluffy_Pillow 31960.6/63371: 50% mana
4:19.887 aoe q arcane_explosion Fluffy_Pillow 28614.5/63371: 45% mana arcane_charge
4:21.195 aoe q arcane_explosion Fluffy_Pillow 25272.3/63371: 40% mana arcane_charge(2)
4:22.503 aoe q arcane_explosion Fluffy_Pillow 21930.1/63371: 35% mana arcane_charge(3)
4:23.809 shared_cds t use_mana_gem Kyrian_Pelagos 18585.4/63371: 29% mana arcane_charge(4)
4:23.809 aoe r arcane_barrage Fluffy_Pillow 24922.5/63371: 39% mana arcane_charge(4)
4:25.115 aoe k radiant_spark Fluffy_Pillow 29112.7/63371: 46% mana
4:26.422 aoe m touch_of_the_magi Fluffy_Pillow 32587.7/69371: 47% mana combat_meditation
4:27.729 aoe n arcane_power Fluffy_Pillow 31901.1/69371: 46% mana arcane_charge(4), combat_meditation
4:27.729 shared_cds v berserking Fluffy_Pillow 31901.1/69371: 46% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:27.729 aoe r arcane_barrage Fluffy_Pillow 31901.1/69371: 46% mana berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:28.917 aoe q arcane_explosion Fluffy_Pillow 36324.2/69371: 52% mana berserking, arcane_power, rune_of_power, combat_meditation
4:30.105 aoe q arcane_explosion Fluffy_Pillow 35472.5/69371: 51% mana berserking, arcane_charge, arcane_power, rune_of_power, combat_meditation
4:31.292 aoe q arcane_explosion Fluffy_Pillow 34619.4/69371: 50% mana berserking, arcane_charge(2), arcane_power, rune_of_power, combat_meditation
4:32.480 aoe q arcane_explosion Fluffy_Pillow 33767.6/69371: 49% mana berserking, arcane_charge(3), arcane_power, rune_of_power, combat_meditation
4:33.668 aoe r arcane_barrage Fluffy_Pillow 32915.9/69371: 47% mana berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:34.856 aoe p arcane_orb Fluffy_Pillow 34109.5/63371: 54% mana berserking, arcane_power, rune_of_power
4:36.046 aoe r arcane_barrage Fluffy_Pillow 35367.8/63371: 56% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:37.235 aoe q arcane_explosion Fluffy_Pillow 39409.6/63371: 62% mana berserking, arcane_power, rune_of_power
4:38.423 aoe q arcane_explosion Fluffy_Pillow 38415.3/63371: 61% mana berserking, arcane_charge, arcane_power, rune_of_power
4:39.611 aoe q arcane_explosion Fluffy_Pillow 37421.0/63371: 59% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:40.800 aoe q arcane_explosion Fluffy_Pillow 36428.0/63371: 57% mana arcane_charge(3), arcane_power
4:42.107 aoe o rune_of_power Fluffy_Pillow 35584.5/63371: 56% mana arcane_charge(4), arcane_power
4:43.413 aoe r arcane_barrage Fluffy_Pillow 37239.8/63371: 59% mana arcane_charge(4), rune_of_power
4:44.719 aoe q arcane_explosion Fluffy_Pillow 41429.9/63371: 65% mana rune_of_power
4:46.025 aoe q arcane_explosion Fluffy_Pillow 38085.2/63371: 60% mana arcane_charge, rune_of_power
4:47.332 aoe q arcane_explosion Fluffy_Pillow 34741.7/63371: 55% mana arcane_charge(2), rune_of_power
4:48.638 aoe q arcane_explosion Fluffy_Pillow 31397.0/63371: 50% mana arcane_charge(3), rune_of_power
4:49.945 aoe r arcane_barrage Fluffy_Pillow 28053.5/63371: 44% mana arcane_charge(4), rune_of_power
4:51.251 aoe q arcane_explosion Fluffy_Pillow 32243.6/63371: 51% mana rune_of_power
4:52.557 aoe q arcane_explosion Fluffy_Pillow 28898.9/63371: 46% mana arcane_charge, clearcasting, rune_of_power
4:53.863 aoe q arcane_explosion Fluffy_Pillow 30554.1/63371: 48% mana arcane_charge(2), rune_of_power
4:55.169 aoe q arcane_explosion Fluffy_Pillow 27209.4/63371: 43% mana arcane_charge(3), rune_of_power
4:56.475 aoe r arcane_barrage Fluffy_Pillow 23864.6/63371: 38% mana arcane_charge(4)
4:57.783 aoe j radiant_spark Fluffy_Pillow 28057.3/63371: 44% mana
4:59.089 aoe p arcane_orb Fluffy_Pillow 28712.6/63371: 45% mana
5:00.396 aoe r arcane_barrage Fluffy_Pillow 29869.1/63371: 47% mana arcane_charge(4)
5:01.702 aoe q arcane_explosion Fluffy_Pillow 34059.2/63371: 54% mana
5:03.007 aoe q arcane_explosion Fluffy_Pillow 30713.2/63371: 48% mana arcane_charge
5:04.313 aoe q arcane_explosion Fluffy_Pillow 27368.5/63371: 43% mana arcane_charge(2)
5:05.620 aoe q arcane_explosion Fluffy_Pillow 24025.0/63371: 38% mana arcane_charge(3)
5:06.926 aoe r arcane_barrage Fluffy_Pillow 20680.3/63371: 33% mana arcane_charge(4)
5:08.234 aoe q arcane_explosion Fluffy_Pillow 24872.9/63371: 39% mana
5:09.539 aoe q arcane_explosion Fluffy_Pillow 21526.9/63371: 34% mana arcane_charge
5:10.845 aoe q arcane_explosion Fluffy_Pillow 18182.2/63371: 29% mana arcane_charge(2)
5:12.152 aoe q arcane_explosion Fluffy_Pillow 14838.7/63371: 23% mana arcane_charge(3)
5:13.460 aoe r arcane_barrage Fluffy_Pillow 11496.5/63371: 18% mana arcane_charge(4)
5:14.767 aoe q arcane_explosion Fluffy_Pillow 15687.9/63371: 25% mana
5:16.075 aoe q arcane_explosion Fluffy_Pillow 12345.7/63371: 19% mana arcane_charge
5:17.381 aoe q arcane_explosion Fluffy_Pillow 9000.9/63371: 14% mana arcane_charge(2)
5:18.689 aoe q arcane_explosion Fluffy_Pillow 5658.7/63371: 9% mana arcane_charge(3)
5:19.997 aoe r arcane_barrage Fluffy_Pillow 2316.5/63371: 4% mana arcane_charge(4)
5:21.303 aoe p arcane_orb Fluffy_Pillow 6506.6/63371: 10% mana
5:22.609 aoe r arcane_barrage Fluffy_Pillow 7661.9/63371: 12% mana arcane_charge(4)
5:23.915 aoe q arcane_explosion Fluffy_Pillow 11852.0/63371: 19% mana
5:25.221 aoe q arcane_explosion Fluffy_Pillow 8507.3/63371: 13% mana arcane_charge
5:26.529 aoe q arcane_explosion Fluffy_Pillow 5165.1/63371: 8% mana arcane_charge(2)
5:27.833 aoe s evocation Fluffy_Pillow 1817.8/63371: 3% mana arcane_charge(3)
5:32.178 aoe q arcane_explosion Fluffy_Pillow 55663.7/63371: 88% mana arcane_charge(3)
5:33.485 aoe r arcane_barrage Fluffy_Pillow 52320.3/63371: 83% mana arcane_charge(4)
5:34.791 aoe k radiant_spark Fluffy_Pillow 56510.4/63371: 89% mana
5:36.097 aoe m touch_of_the_magi Fluffy_Pillow 62578.1/69371: 90% mana combat_meditation
5:37.404 aoe o rune_of_power Fluffy_Pillow 61891.5/69371: 89% mana arcane_charge(4), combat_meditation
5:38.710 aoe r arcane_barrage Fluffy_Pillow 63703.4/69371: 92% mana arcane_charge(4), rune_of_power, combat_meditation
5:40.016 aoe q arcane_explosion Fluffy_Pillow 68290.3/69371: 98% mana rune_of_power, combat_meditation
5:41.324 aoe q arcane_explosion Fluffy_Pillow 65105.0/69371: 94% mana arcane_charge, rune_of_power, combat_meditation
5:42.631 aoe q arcane_explosion Fluffy_Pillow 61918.4/69371: 89% mana arcane_charge(2), clearcasting, rune_of_power, combat_meditation
5:43.938 aoe q arcane_explosion Fluffy_Pillow 63731.8/69371: 92% mana arcane_charge(3), rune_of_power, combat_meditation
5:45.244 aoe r arcane_barrage Fluffy_Pillow 55307.3/63371: 87% mana arcane_charge(4), rune_of_power
5:46.552 aoe p arcane_orb Fluffy_Pillow 59499.9/63371: 94% mana rune_of_power
5:47.861 aoe r arcane_barrage Fluffy_Pillow 60659.0/63371: 96% mana arcane_charge(4), rune_of_power
5:49.168 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
5:50.476 aoe q arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge, rune_of_power
5:51.781 aoe q arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), clearcasting
5:53.086 aoe q arcane_explosion Fluffy_Pillow 58337.2/63371: 92% mana arcane_charge(3)
5:54.391 aoe r arcane_barrage Fluffy_Pillow 54991.2/63371: 87% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Pelagos"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=328266//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Emeni : 11804 dps, 5195 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11804.4 11804.4 23.3 / 0.198% 1540.6 / 13.1% 5.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2183.6 2071.5 Mana 0.00% 49.2 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 11804
Arcane Barrage 3161 26.8% 49.5 5.65sec 19136 14952 Direct 148.2 5364 10665 6387 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.47 148.20 0.00 0.00 1.2799 0.0000 946716.70 946716.70 0.00% 14951.78 14951.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 119.58 89 156 5363.83 1153 31802 5366.05 4754 6228 641405 641405 0.00%
crit 19.31% 28.62 12 47 10664.99 2926 63605 10673.43 6816 16344 305312 305312 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:49.24
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.01
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
    rotation
    [x]:0.21
Arcane Blast 3076 26.1% 30.0 7.97sec 30827 28682 Direct 86.7 8937 17871 10675 19.5%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.02 86.68 0.00 0.00 1.0748 0.0000 925342.07 925342.07 0.00% 28682.11 28682.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 69.81 35 89 8937.40 1324 13842 8942.76 7482 9719 623931 623931 0.00%
crit 19.46% 16.87 4 31 17871.49 2648 27684 17884.60 12349 23004 301411 301411 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    aoe
    [o]:30.09
  • if_expr:buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
    rotation
    [w]:0.11
Arcane Echo 271 2.3% 38.3 7.34sec 2122 0 Direct 114.8 594 1185 707 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.26 114.79 0.00 0.00 0.0000 0.0000 81178.85 81178.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 92.74 61 121 593.89 443 841 593.26 517 644 55058 55058 0.00%
crit 19.21% 22.05 8 41 1184.91 886 1681 1183.13 886 1474 26121 26121 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 3520 29.8% 128.2 2.13sec 8224 6436 Direct 384.5 2296 4599 2741 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 128.16 384.47 0.00 0.00 1.2778 0.0000 1053940.01 1053940.01 0.00% 6436.16 6436.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 310.08 249 399 2295.66 1958 4112 2296.87 2230 2387 711802 711802 0.00%
crit 19.35% 74.39 42 118 4599.14 3916 8223 4601.51 4267 5054 342138 342138 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:128.13
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (696) 0.0% (5.9%) 11.7 24.67sec 17870 13953

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.67 0.00 0.00 0.00 1.2808 0.0000 0.00 0.00 0.00% 13952.95 13952.95

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:11.65
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [v]:0.02
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 696 5.9% 35.0 24.66sec 5967 0 Direct 35.0 4995 9983 5966 19.5%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.96 34.96 0.00 0.00 0.0000 0.0000 208582.70 208582.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.52% 28.15 17 40 4994.95 3869 8126 4997.52 4270 5496 140581 140581 0.00%
crit 19.48% 6.81 1 18 9982.95 7739 16251 9994.98 7739 16251 68002 68002 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (64) 0.0% (0.5%) 13.7 1.79sec 1389 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 64 0.5% 13.7 1.79sec 1389 0 Direct 13.7 1164 2327 1389 19.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.67 13.67 0.00 0.00 0.0000 0.0000 18990.32 18990.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 11.03 4 17 1163.53 1164 1164 1163.53 1164 1164 12829 12829 0.00%
crit 19.36% 2.65 0 9 2327.06 2327 2327 2172.18 0 2327 6161 6161 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1754 18.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1756.86 1756.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.35% 0.81 0 1 1480.68 1481 1481 1204.49 0 1481 1204 1204 0.00%
crit 18.65% 0.19 0 1 2961.35 2961 2961 552.36 0 2961 552 552 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (22) 0.0% (0.2%) 1.0 0.00sec 6503 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 163  / 22 0.2% 90.0 1.29sec 72 55 Direct 90.0 61 121 72 19.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6502.76 6502.76 0.00% 55.21 55.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.00% 72.90 57 84 60.75 43 69 60.75 59 63 4429 4429 0.00%
crit 19.00% 17.10 6 33 121.32 86 139 121.31 104 139 2074 2074 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (989) 0.0% (8.4%) 6.2 51.37sec 47422 37686

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.24 0.00 0.00 0.00 1.2584 0.0000 0.00 0.00 0.00% 37685.58 37685.58

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.25
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 989 8.4% 6.2 51.28sec 47422 0 Direct 18.6 15871 0 15871 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.24 18.65 0.00 0.00 0.0000 0.0000 295794.15 295794.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.65 15 21 15870.53 2767 73738 15879.54 10524 21511 295794 295794 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11261.83
  • base_dd_max:11261.83
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Emeni
Arcane Power 2.9 126.32sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.86
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 253.07sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [{]:1.86
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.9 253.28sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.87 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.89
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 2.1 173.75sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.09 0.00 12.41 0.00 3.9036 0.6540 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:2.09
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [z]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.8 251.14sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.83
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
    cooldowns
    [t]:0.01
  • if_expr:debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Rune of Power 6.1 50.08sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.11 0.00 0.00 0.00 1.2574 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.13
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.9 120.95sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [y]:2.95
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.2 160.8 6.0sec 1.4sec 4.5sec 75.87% 0.00% 30.0 (30.1) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 30.9s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.6s

Stack Uptimes

  • arcane_charge_1:16.99%
  • arcane_charge_2:14.55%
  • arcane_charge_3:15.03%
  • arcane_charge_4:29.30%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 126.4sec 126.4sec 14.7sec 14.02% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.8s / 133.7s
  • trigger_min/max:120.8s / 133.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.02%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 253.1sec 253.1sec 11.7sec 7.22% 32.67% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:249.3s / 259.7s
  • trigger_min/max:249.3s / 259.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.22%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.2 3.7 13.2sec 11.3sec 3.2sec 23.86% 0.00% 1.2 (1.2) 0.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:17.82%
  • clearcasting_2:3.00%
  • clearcasting_3:3.05%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.9 0.0 253.3sec 253.3sec 19.1sec 11.83% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:249.2s / 259.4s
  • trigger_min/max:249.2s / 259.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • deathborne_1:11.83%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 2.1 0.0 168.3sec 168.3sec 3.9sec 2.68% 0.00% 8.3 (8.3) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.0s / 305.8s
  • trigger_min/max:90.0s / 305.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:2.68%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lead by Example 1.9 0.0 253.3sec 253.3sec 28.0sec 17.29% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:249.2s / 259.4s
  • trigger_min/max:249.2s / 259.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • lead_by_example_1:17.29%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.8 0.0 250.4sec 250.4sec 2.3sec 1.43% 18.07% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:63.4s / 259.0s
  • trigger_min/max:63.4s / 259.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 141.3s

Stack Uptimes

  • presence_of_mind_1:0.63%
  • presence_of_mind_2:0.64%
  • presence_of_mind_3:0.15%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 9.0 0.0 34.4sec 34.4sec 11.8sec 35.28% 0.00% 0.0 (0.0) 8.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 53.2s
  • trigger_min/max:13.1s / 53.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.28%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.06% 0.00% 3.77%
Arcane Barrage Arcane Charge 2 0.13% 0.00% 7.55%
Arcane Barrage Arcane Charge 3 0.22% 0.00% 5.45%
Arcane Barrage Arcane Charge 4 99.59% 88.68% 100.00%
Arcane Blast Arcane Charge 0 1.37% 0.00% 7.14%
Arcane Blast Arcane Charge 1 0.96% 0.00% 9.38%
Arcane Blast Arcane Charge 2 0.72% 0.00% 7.50%
Arcane Blast Arcane Charge 3 0.53% 0.00% 6.67%
Arcane Blast Arcane Charge 4 96.41% 71.88% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 0.48% 0.14% 2.96% 0.7s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.091120.122239.871
Evocation59.4040.000215.833146.63646.171253.480
Rune of Power5.5230.00426.52334.97319.62051.888
Touch of the Magi4.4470.00025.40528.94517.74550.582
Arcane Power4.9650.77613.71914.6313.10222.038
Arcane Barrage3.4780.00328.290174.401134.698210.491
Arcane Orb6.1660.00035.00474.25247.93998.622
Deathborne33.5250.00078.12271.31858.82078.122
Presence of Mind90.1301.020197.147202.03952.341235.661

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
mana_regen Mana 829.25 377372.37 60.70% 455.08 2408.63 0.63%
Evocation Mana 90.95 101165.96 16.27% 1112.36 0.00 0.00%
Mana Gem Mana 2.95 18682.49 3.01% 6337.14 0.00 0.00%
Arcane Barrage Mana 49.46 124463.87 20.02% 2516.38 691.36 0.55%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 2071.47 2183.58 3102.5 29728.2 154.2 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
arcane_blast Mana 30.1 125351.4 4170.4 4176.0 7.4
arcane_explosion Mana 128.1 503173.2 3927.0 3926.2 2.1
arcane_orb Mana 11.7 5585.0 478.6 478.5 37.3
deathborne Mana 1.9 4677.6 2500.0 2502.3 0.0
touch_of_the_magi Mana 6.2 15586.0 2500.0 2498.8 19.0

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Necrolord_Emeni Damage Per Second
Count 1217
Mean 11804.42
Minimum 10636.34
Maximum 13204.22
Spread ( max - min ) 2567.88
Range [ ( max - min ) / 2 * 100% ] 10.88%
Standard Deviation 414.9940
5th Percentile 11159.78
95th Percentile 12479.34
( 95th Percentile - 5th Percentile ) 1319.56
Mean Distribution
Standard Deviation 11.8959
95.00% Confidence Interval ( 11781.10 - 11827.73 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4748
0.1 Scale Factor Error with Delta=300 1471
0.05 Scale Factor Error with Delta=300 5881
0.01 Scale Factor Error with Delta=300 147017
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 1217
Mean 5195.31
Minimum 4508.16
Maximum 6065.29
Spread ( max - min ) 1557.13
Range [ ( max - min ) / 2 * 100% ] 14.99%
Standard Deviation 228.5267
5th Percentile 4827.97
95th Percentile 5579.69
( 95th Percentile - 5th Percentile ) 751.72
Mean Distribution
Standard Deviation 6.5508
95.00% Confidence Interval ( 5182.47 - 5208.15 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7433
0.1 Scale Factor Error with Delta=300 446
0.05 Scale Factor Error with Delta=300 1784
0.01 Scale Factor Error with Delta=300 44582
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 1217
Mean 11804.42
Minimum 10636.34
Maximum 13204.22
Spread ( max - min ) 2567.88
Range [ ( max - min ) / 2 * 100% ] 10.88%
Damage
Necrolord_Emeni Damage
Count 1217
Mean 3532301.67
Minimum 2692772.64
Maximum 4200179.83
Spread ( max - min ) 1507407.19
Range [ ( max - min ) / 2 * 100% ] 21.34%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.89 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.25 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.86 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.13 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.83 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
o 30.09 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 11.65 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 128.13 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 49.24 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 2.09 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.cooldowns
# count action,conditions
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
Prioritize using grisly icicle with ap. Use it with totm otherwise.
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
0.00 mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
0.00 mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
0.00 deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
0.00 deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
0.00 touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
0.00 arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
0.00 rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
0.00 presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
t 0.01 presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
u 0.01 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
v 0.02 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
w 0.11 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
x 0.21 arcane_barrage
actions.shared_cds
# count action,conditions
y 2.95 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
z 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
{ 1.86 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklz{oooyooonooooooomoooooorprqqqqrqqqqrqqqqrqsqqqrprqqqqrqkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqyqlrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqyrqqqqrjkl{oooonoooooomoooroqqqrprqqqqrqqqqrqqsqqrprqqkmrqqqqrqqqqrprqqqqrqqqqrqqqqrpr

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, deathborne, lead_by_example
0:02.312 aoe l arcane_power Fluffy_Pillow 59651.5/63371: 94% mana bloodlust, arcane_charge(4), deathborne, lead_by_example
0:02.312 shared_cds z potion Fluffy_Pillow 59651.5/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
0:02.312 shared_cds { berserking Fluffy_Pillow 59651.5/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:02.312 aoe o arcane_blast Fluffy_Pillow 59651.5/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:03.243 aoe o arcane_blast Fluffy_Pillow 57394.0/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:04.178 aoe o arcane_blast Fluffy_Pillow 55141.6/63371: 87% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.110 shared_cds y use_mana_gem Necrolord_Emeni 52885.3/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.110 aoe o arcane_blast Fluffy_Pillow 59222.4/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.042 aoe o arcane_blast Fluffy_Pillow 56966.2/63371: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.975 aoe o arcane_blast Fluffy_Pillow 54711.2/63371: 86% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:07.906 aoe n presence_of_mind Fluffy_Pillow 52453.7/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:07.906 aoe o arcane_blast Fluffy_Pillow 52453.7/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:08.820 aoe o arcane_blast Fluffy_Pillow 50174.6/63371: 79% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:09.734 aoe o arcane_blast Fluffy_Pillow 47895.5/63371: 76% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:10.649 aoe o arcane_blast Fluffy_Pillow 45617.7/63371: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:11.581 aoe o arcane_blast Fluffy_Pillow 43361.5/63371: 68% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:12.513 aoe o arcane_blast Fluffy_Pillow 41105.2/63371: 65% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:13.445 aoe o arcane_blast Fluffy_Pillow 38849.0/63371: 61% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:14.377 aoe m rune_of_power Fluffy_Pillow 36592.7/63371: 58% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(2), deathborne, lead_by_example, potion_of_deathly_fixation
0:15.384 aoe o arcane_blast Fluffy_Pillow 37869.0/63371: 60% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:16.410 aoe o arcane_blast Fluffy_Pillow 35731.9/63371: 56% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:17.437 aoe o arcane_blast Fluffy_Pillow 30158.5/63371: 48% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:18.464 aoe o arcane_blast Fluffy_Pillow 24585.2/63371: 39% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:19.490 aoe o arcane_blast Fluffy_Pillow 19010.6/63371: 30% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:20.517 aoe o arcane_blast Fluffy_Pillow 13437.2/63371: 21% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:21.544 aoe r arcane_barrage Fluffy_Pillow 7863.9/63371: 12% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:22.551 aoe p arcane_orb Fluffy_Pillow 11675.0/63371: 18% mana bloodlust, clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:23.559 aoe r arcane_barrage Fluffy_Pillow 12452.6/63371: 20% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:24.567 aoe q arcane_explosion Fluffy_Pillow 16265.0/63371: 26% mana bloodlust, clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:25.573 aoe q arcane_explosion Fluffy_Pillow 17540.0/63371: 28% mana bloodlust, arcane_charge, clearcasting, rune_of_power, lead_by_example, potion_of_deathly_fixation
0:26.580 aoe q arcane_explosion Fluffy_Pillow 18816.3/63371: 30% mana bloodlust, arcane_charge(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:27.586 aoe q arcane_explosion Fluffy_Pillow 15091.4/63371: 24% mana bloodlust, arcane_charge(3), clearcasting, lead_by_example
0:28.593 aoe r arcane_barrage Fluffy_Pillow 16367.7/63371: 26% mana bloodlust, arcane_charge(4), lead_by_example
0:29.600 aoe q arcane_explosion Fluffy_Pillow 20178.8/63371: 32% mana bloodlust, lead_by_example
0:30.607 aoe q arcane_explosion Fluffy_Pillow 16455.1/63371: 26% mana bloodlust, arcane_charge, clearcasting, lead_by_example
0:31.613 aoe q arcane_explosion Fluffy_Pillow 17730.2/63371: 28% mana bloodlust, arcane_charge(2)
0:32.621 aoe q arcane_explosion Fluffy_Pillow 14007.7/63371: 22% mana bloodlust, arcane_charge(3)
0:33.626 aoe r arcane_barrage Fluffy_Pillow 10281.5/63371: 16% mana bloodlust, arcane_charge(4)
0:34.631 aoe q arcane_explosion Fluffy_Pillow 14090.1/63371: 22% mana bloodlust
0:35.638 aoe q arcane_explosion Fluffy_Pillow 10366.4/63371: 16% mana bloodlust, arcane_charge, clearcasting
0:36.645 aoe q arcane_explosion Fluffy_Pillow 11642.7/63371: 18% mana bloodlust, arcane_charge(2)
0:37.652 aoe q arcane_explosion Fluffy_Pillow 7919.0/63371: 12% mana bloodlust, arcane_charge(3)
0:38.659 aoe r arcane_barrage Fluffy_Pillow 4195.3/63371: 7% mana bloodlust, arcane_charge(4)
0:39.665 aoe q arcane_explosion Fluffy_Pillow 8005.2/63371: 13% mana bloodlust
0:40.672 aoe s evocation Necrolord_Emeni 4281.5/63371: 7% mana bloodlust, arcane_charge
0:44.016 aoe q arcane_explosion Fluffy_Pillow 58151.0/63371: 92% mana arcane_charge
0:45.322 aoe q arcane_explosion Fluffy_Pillow 54806.3/63371: 86% mana arcane_charge(2)
0:46.630 aoe q arcane_explosion Fluffy_Pillow 51464.1/63371: 81% mana arcane_charge(3), clearcasting
0:47.936 aoe r arcane_barrage Fluffy_Pillow 53119.3/63371: 84% mana arcane_charge(4)
0:49.243 aoe p arcane_orb Fluffy_Pillow 57310.7/63371: 90% mana
0:50.551 aoe r arcane_barrage Fluffy_Pillow 58468.5/63371: 92% mana arcane_charge(4), clearcasting
0:51.858 aoe q arcane_explosion Fluffy_Pillow 62659.9/63371: 99% mana clearcasting
0:53.166 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge
0:54.471 aoe q arcane_explosion Fluffy_Pillow 60025.4/63371: 95% mana arcane_charge(2)
0:55.776 aoe q arcane_explosion Fluffy_Pillow 56679.4/63371: 89% mana arcane_charge(3)
0:57.084 aoe r arcane_barrage Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(4), clearcasting
0:58.390 aoe q arcane_explosion Fluffy_Pillow 57527.3/63371: 91% mana clearcasting
0:59.694 aoe k touch_of_the_magi Fluffy_Pillow 59180.1/63371: 93% mana arcane_charge
1:01.002 aoe m rune_of_power Fluffy_Pillow 58337.9/63371: 92% mana arcane_charge(4)
1:02.310 aoe r arcane_barrage Fluffy_Pillow 59995.7/63371: 95% mana arcane_charge(4), rune_of_power
1:03.619 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
1:04.925 aoe q arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power
1:06.232 aoe q arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), rune_of_power
1:07.537 aoe q arcane_explosion Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(3), rune_of_power
1:08.845 aoe r arcane_barrage Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4), rune_of_power
1:10.151 aoe p arcane_orb Fluffy_Pillow 54185.1/63371: 86% mana rune_of_power
1:11.458 aoe r arcane_barrage Fluffy_Pillow 55341.7/63371: 87% mana arcane_charge(4), rune_of_power
1:12.765 aoe q arcane_explosion Fluffy_Pillow 59533.0/63371: 94% mana rune_of_power
1:14.072 aoe q arcane_explosion Fluffy_Pillow 56189.6/63371: 89% mana arcane_charge, rune_of_power
1:15.380 aoe q arcane_explosion Fluffy_Pillow 52847.4/63371: 83% mana arcane_charge(2)
1:16.686 aoe q arcane_explosion Fluffy_Pillow 49502.6/63371: 78% mana arcane_charge(3)
1:17.993 aoe r arcane_barrage Fluffy_Pillow 46159.2/63371: 73% mana arcane_charge(4)
1:19.300 aoe q arcane_explosion Fluffy_Pillow 50350.5/63371: 79% mana
1:20.606 aoe q arcane_explosion Fluffy_Pillow 47005.8/63371: 74% mana arcane_charge, clearcasting
1:21.912 aoe q arcane_explosion Fluffy_Pillow 48661.1/63371: 77% mana arcane_charge(2)
1:23.218 aoe q arcane_explosion Fluffy_Pillow 45316.3/63371: 72% mana arcane_charge(3)
1:24.525 aoe r arcane_barrage Fluffy_Pillow 41972.9/63371: 66% mana arcane_charge(4), clearcasting
1:25.832 aoe q arcane_explosion Fluffy_Pillow 46164.2/63371: 73% mana clearcasting
1:27.138 aoe q arcane_explosion Fluffy_Pillow 47819.5/63371: 75% mana arcane_charge
1:28.444 aoe q arcane_explosion Fluffy_Pillow 44474.8/63371: 70% mana arcane_charge(2)
1:29.751 aoe q arcane_explosion Fluffy_Pillow 41131.3/63371: 65% mana arcane_charge(3), clearcasting
1:31.057 aoe r arcane_barrage Fluffy_Pillow 42786.6/63371: 68% mana arcane_charge(4)
1:32.363 aoe p arcane_orb Fluffy_Pillow 46976.7/63371: 74% mana
1:33.670 aoe r arcane_barrage Fluffy_Pillow 48133.2/63371: 76% mana arcane_charge(4)
1:34.977 aoe q arcane_explosion Fluffy_Pillow 52324.6/63371: 83% mana
1:36.285 aoe q arcane_explosion Fluffy_Pillow 48982.4/63371: 77% mana arcane_charge
1:37.591 aoe q arcane_explosion Fluffy_Pillow 45637.7/63371: 72% mana arcane_charge(2)
1:38.898 aoe q arcane_explosion Fluffy_Pillow 42294.2/63371: 67% mana arcane_charge(3)
1:40.205 aoe r arcane_barrage Fluffy_Pillow 38950.7/63371: 61% mana arcane_charge(4)
1:41.511 aoe q arcane_explosion Fluffy_Pillow 43140.8/63371: 68% mana
1:42.818 aoe q arcane_explosion Fluffy_Pillow 39797.4/63371: 63% mana arcane_charge, clearcasting
1:44.125 aoe q arcane_explosion Fluffy_Pillow 41453.9/63371: 65% mana arcane_charge(2)
1:45.432 aoe q arcane_explosion Fluffy_Pillow 38110.4/63371: 60% mana arcane_charge(3)
1:46.738 aoe r arcane_barrage Fluffy_Pillow 34765.7/63371: 55% mana arcane_charge(4), clearcasting
1:48.044 aoe k touch_of_the_magi Fluffy_Pillow 38955.8/63371: 61% mana clearcasting
1:49.351 aoe m rune_of_power Fluffy_Pillow 38112.3/63371: 60% mana arcane_charge(4), clearcasting
1:50.657 aoe r arcane_barrage Fluffy_Pillow 39767.6/63371: 63% mana arcane_charge(4), clearcasting, rune_of_power
1:51.965 aoe q arcane_explosion Fluffy_Pillow 43960.2/63371: 69% mana clearcasting, rune_of_power
1:53.270 aoe q arcane_explosion Fluffy_Pillow 45614.2/63371: 72% mana arcane_charge, rune_of_power
1:54.575 aoe q arcane_explosion Fluffy_Pillow 42268.2/63371: 67% mana arcane_charge(2), rune_of_power
1:55.882 aoe q arcane_explosion Fluffy_Pillow 38924.8/63371: 61% mana arcane_charge(3), rune_of_power
1:57.188 aoe r arcane_barrage Fluffy_Pillow 35580.0/63371: 56% mana arcane_charge(4), clearcasting, rune_of_power
1:58.495 aoe p arcane_orb Fluffy_Pillow 39771.4/63371: 63% mana clearcasting, rune_of_power
1:59.801 aoe r arcane_barrage Fluffy_Pillow 40926.7/63371: 65% mana arcane_charge(4), clearcasting, rune_of_power
2:01.107 aoe q arcane_explosion Fluffy_Pillow 45116.8/63371: 71% mana clearcasting, rune_of_power
2:02.415 aoe q arcane_explosion Fluffy_Pillow 46774.6/63371: 74% mana arcane_charge, rune_of_power
2:03.721 aoe q arcane_explosion Fluffy_Pillow 43429.8/63371: 69% mana arcane_charge(2)
2:05.027 shared_cds y use_mana_gem Necrolord_Emeni 40085.1/63371: 63% mana arcane_charge(3)
2:05.110 aoe q arcane_explosion Fluffy_Pillow 46527.5/63371: 73% mana arcane_charge(3)
2:06.415 aoe l arcane_power Fluffy_Pillow 43181.4/63371: 68% mana arcane_charge(4), clearcasting
2:06.415 aoe r arcane_barrage Fluffy_Pillow 43181.4/63371: 68% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
2:07.723 aoe q arcane_explosion Fluffy_Pillow 47374.1/63371: 75% mana arcane_power, clearcasting, rune_of_power
2:09.031 aoe q arcane_explosion Fluffy_Pillow 49031.9/63371: 77% mana arcane_charge, arcane_power, rune_of_power
2:10.338 aoe q arcane_explosion Fluffy_Pillow 48188.4/63371: 76% mana arcane_charge(2), arcane_power, rune_of_power
2:11.645 aoe q arcane_explosion Fluffy_Pillow 47345.0/63371: 75% mana arcane_charge(3), arcane_power, rune_of_power
2:12.951 aoe r arcane_barrage Fluffy_Pillow 46500.2/63371: 73% mana arcane_charge(4), arcane_power, rune_of_power
2:14.257 aoe q arcane_explosion Fluffy_Pillow 50690.3/63371: 80% mana arcane_power, rune_of_power
2:15.563 aoe q arcane_explosion Fluffy_Pillow 49845.6/63371: 79% mana arcane_charge, arcane_power, rune_of_power
2:16.868 aoe q arcane_explosion Fluffy_Pillow 48999.6/63371: 77% mana arcane_charge(2), arcane_power, rune_of_power
2:18.174 aoe q arcane_explosion Fluffy_Pillow 48154.9/63371: 76% mana arcane_charge(3), arcane_power, rune_of_power
2:19.480 aoe r arcane_barrage Fluffy_Pillow 47310.1/63371: 75% mana arcane_charge(4), arcane_power
2:20.785 aoe p arcane_orb Fluffy_Pillow 51499.0/63371: 81% mana arcane_power
2:22.092 aoe r arcane_barrage Fluffy_Pillow 52905.5/63371: 83% mana arcane_charge(4)
2:23.398 aoe q arcane_explosion Fluffy_Pillow 57095.6/63371: 90% mana
2:24.705 aoe q arcane_explosion Fluffy_Pillow 53752.1/63371: 85% mana arcane_charge
2:26.012 aoe q arcane_explosion Fluffy_Pillow 50408.7/63371: 80% mana arcane_charge(2)
2:27.319 aoe q arcane_explosion Fluffy_Pillow 47065.2/63371: 74% mana arcane_charge(3)
2:28.624 aoe r arcane_barrage Fluffy_Pillow 43719.2/63371: 69% mana arcane_charge(4), clearcasting
2:29.931 aoe q arcane_explosion Fluffy_Pillow 47910.6/63371: 76% mana clearcasting
2:31.237 aoe q arcane_explosion Fluffy_Pillow 49565.8/63371: 78% mana arcane_charge
2:32.544 aoe q arcane_explosion Fluffy_Pillow 46222.4/63371: 73% mana arcane_charge(2)
2:33.849 aoe q arcane_explosion Fluffy_Pillow 42876.4/63371: 68% mana arcane_charge(3)
2:35.156 aoe r arcane_barrage Fluffy_Pillow 39532.9/63371: 62% mana arcane_charge(4)
2:36.463 aoe k touch_of_the_magi Fluffy_Pillow 43724.3/63371: 69% mana
2:37.769 aoe m rune_of_power Fluffy_Pillow 42879.5/63371: 68% mana arcane_charge(4), clearcasting
2:39.075 aoe r arcane_barrage Fluffy_Pillow 44534.8/63371: 70% mana arcane_charge(4), clearcasting, rune_of_power
2:40.382 aoe q arcane_explosion Fluffy_Pillow 48726.2/63371: 77% mana clearcasting, rune_of_power
2:41.689 aoe q arcane_explosion Fluffy_Pillow 50382.7/63371: 80% mana arcane_charge, rune_of_power
2:42.995 aoe q arcane_explosion Fluffy_Pillow 47038.0/63371: 74% mana arcane_charge(2), clearcasting, rune_of_power
2:44.300 aoe q arcane_explosion Fluffy_Pillow 48692.0/63371: 77% mana arcane_charge(3), rune_of_power
2:45.607 aoe r arcane_barrage Fluffy_Pillow 45348.5/63371: 72% mana arcane_charge(4), rune_of_power
2:46.913 aoe p arcane_orb Fluffy_Pillow 49538.6/63371: 78% mana rune_of_power
2:48.219 aoe r arcane_barrage Fluffy_Pillow 50693.9/63371: 80% mana arcane_charge(4), rune_of_power
2:49.525 aoe q arcane_explosion Fluffy_Pillow 54884.0/63371: 87% mana rune_of_power
2:50.831 aoe q arcane_explosion Fluffy_Pillow 51539.3/63371: 81% mana arcane_charge, clearcasting, rune_of_power
2:52.138 aoe q arcane_explosion Fluffy_Pillow 53195.8/63371: 84% mana arcane_charge(2)
2:53.444 aoe q arcane_explosion Fluffy_Pillow 49851.1/63371: 79% mana arcane_charge(3)
2:54.751 aoe r arcane_barrage Fluffy_Pillow 46507.6/63371: 73% mana arcane_charge(4), clearcasting
2:56.056 aoe q arcane_explosion Fluffy_Pillow 50696.4/63371: 80% mana clearcasting
2:57.364 aoe q arcane_explosion Fluffy_Pillow 52354.2/63371: 83% mana arcane_charge
2:58.671 aoe q arcane_explosion Fluffy_Pillow 49010.8/63371: 77% mana arcane_charge(2)
2:59.976 aoe q arcane_explosion Fluffy_Pillow 45664.8/63371: 72% mana arcane_charge(3)
3:01.283 aoe r arcane_barrage Fluffy_Pillow 42321.3/63371: 67% mana arcane_charge(4)
3:02.590 aoe q arcane_explosion Fluffy_Pillow 46512.7/63371: 73% mana
3:03.897 aoe q arcane_explosion Fluffy_Pillow 43169.2/63371: 68% mana arcane_charge, clearcasting
3:05.202 aoe q arcane_explosion Fluffy_Pillow 44823.2/63371: 71% mana arcane_charge(2)
3:06.510 aoe q arcane_explosion Fluffy_Pillow 41481.0/63371: 65% mana arcane_charge(3)
3:07.816 aoe r arcane_barrage Fluffy_Pillow 38136.3/63371: 60% mana arcane_charge(4)
3:09.121 aoe p arcane_orb Fluffy_Pillow 42325.1/63371: 67% mana
3:10.429 aoe r arcane_barrage Fluffy_Pillow 43482.9/63371: 69% mana arcane_charge(4)
3:11.736 aoe q arcane_explosion Fluffy_Pillow 47674.3/63371: 75% mana
3:13.043 aoe q arcane_explosion Fluffy_Pillow 44330.8/63371: 70% mana arcane_charge
3:14.351 aoe q arcane_explosion Fluffy_Pillow 40988.6/63371: 65% mana arcane_charge(2), clearcasting
3:15.656 aoe q arcane_explosion Fluffy_Pillow 42642.6/63371: 67% mana arcane_charge(3)
3:16.964 aoe r arcane_barrage Fluffy_Pillow 39300.4/63371: 62% mana arcane_charge(4), clearcasting
3:18.271 aoe q arcane_explosion Fluffy_Pillow 43491.8/63371: 69% mana clearcasting
3:19.578 aoe q arcane_explosion Fluffy_Pillow 45148.3/63371: 71% mana arcane_charge
3:20.885 aoe q arcane_explosion Fluffy_Pillow 41804.9/63371: 66% mana arcane_charge(2)
3:22.190 aoe q arcane_explosion Fluffy_Pillow 38458.8/63371: 61% mana arcane_charge(3)
3:23.496 aoe r arcane_barrage Fluffy_Pillow 35114.1/63371: 55% mana arcane_charge(4)
3:24.800 aoe k touch_of_the_magi Fluffy_Pillow 39301.7/63371: 62% mana
3:26.105 aoe m rune_of_power Fluffy_Pillow 38455.7/63371: 61% mana arcane_charge(4)
3:27.412 aoe r arcane_barrage Fluffy_Pillow 40112.2/63371: 63% mana arcane_charge(4), rune_of_power
3:28.718 aoe q arcane_explosion Fluffy_Pillow 44302.3/63371: 70% mana rune_of_power
3:30.025 aoe q arcane_explosion Fluffy_Pillow 40958.9/63371: 65% mana arcane_charge, rune_of_power
3:31.333 aoe q arcane_explosion Fluffy_Pillow 37616.7/63371: 59% mana arcane_charge(2), rune_of_power
3:32.641 aoe q arcane_explosion Fluffy_Pillow 34274.5/63371: 54% mana arcane_charge(3), clearcasting, rune_of_power
3:33.947 aoe r arcane_barrage Fluffy_Pillow 35929.7/63371: 57% mana arcane_charge(4), rune_of_power
3:35.254 aoe p arcane_orb Fluffy_Pillow 40121.1/63371: 63% mana rune_of_power
3:36.561 aoe r arcane_barrage Fluffy_Pillow 41277.6/63371: 65% mana arcane_charge(4), rune_of_power
3:37.869 aoe q arcane_explosion Fluffy_Pillow 45470.3/63371: 72% mana rune_of_power
3:39.173 aoe q arcane_explosion Fluffy_Pillow 42123.0/63371: 66% mana arcane_charge, clearcasting, rune_of_power
3:40.479 aoe q arcane_explosion Fluffy_Pillow 43778.3/63371: 69% mana arcane_charge(2)
3:41.786 aoe q arcane_explosion Fluffy_Pillow 40434.8/63371: 64% mana arcane_charge(3)
3:43.091 aoe r arcane_barrage Fluffy_Pillow 37088.8/63371: 59% mana arcane_charge(4)
3:44.398 aoe q arcane_explosion Fluffy_Pillow 41280.2/63371: 65% mana
3:45.704 aoe q arcane_explosion Fluffy_Pillow 37935.4/63371: 60% mana arcane_charge
3:47.010 aoe q arcane_explosion Fluffy_Pillow 34590.7/63371: 55% mana arcane_charge(2)
3:48.316 aoe q arcane_explosion Fluffy_Pillow 31246.0/63371: 49% mana arcane_charge(3)
3:49.622 aoe r arcane_barrage Fluffy_Pillow 27901.2/63371: 44% mana arcane_charge(4), clearcasting
3:50.928 aoe q arcane_explosion Fluffy_Pillow 32091.3/63371: 51% mana clearcasting
3:52.235 aoe q arcane_explosion Fluffy_Pillow 33747.9/63371: 53% mana arcane_charge
3:53.540 aoe q arcane_explosion Fluffy_Pillow 30401.9/63371: 48% mana arcane_charge(2), clearcasting
3:54.847 aoe q arcane_explosion Fluffy_Pillow 32058.4/63371: 51% mana arcane_charge(3)
3:56.153 aoe r arcane_barrage Fluffy_Pillow 28713.7/63371: 45% mana arcane_charge(4)
3:57.458 aoe p arcane_orb Fluffy_Pillow 32902.5/63371: 52% mana
3:58.764 aoe r arcane_barrage Fluffy_Pillow 34057.8/63371: 54% mana arcane_charge(4)
4:00.070 aoe q arcane_explosion Fluffy_Pillow 38247.9/63371: 60% mana
4:01.375 aoe q arcane_explosion Fluffy_Pillow 34901.9/63371: 55% mana arcane_charge
4:02.682 aoe q arcane_explosion Fluffy_Pillow 31558.4/63371: 50% mana arcane_charge(2)
4:03.990 aoe q arcane_explosion Fluffy_Pillow 28216.2/63371: 45% mana arcane_charge(3)
4:05.297 shared_cds y use_mana_gem Necrolord_Emeni 24872.7/63371: 39% mana arcane_charge(4), clearcasting
4:05.297 aoe r arcane_barrage Fluffy_Pillow 31209.9/63371: 49% mana arcane_charge(4), clearcasting
4:06.605 aoe q arcane_explosion Fluffy_Pillow 35402.5/63371: 56% mana clearcasting
4:07.911 aoe q arcane_explosion Fluffy_Pillow 37057.8/63371: 58% mana arcane_charge
4:09.220 aoe q arcane_explosion Fluffy_Pillow 33716.9/63371: 53% mana arcane_charge(2)
4:10.527 aoe q arcane_explosion Fluffy_Pillow 30373.4/63371: 48% mana arcane_charge(3), clearcasting
4:11.832 aoe r arcane_barrage Fluffy_Pillow 32027.4/63371: 51% mana arcane_charge(4)
4:13.139 aoe j deathborne Fluffy_Pillow 36218.8/63371: 57% mana
4:14.446 aoe k touch_of_the_magi Fluffy_Pillow 35375.3/63371: 56% mana deathborne, lead_by_example
4:15.751 aoe l arcane_power Fluffy_Pillow 34529.3/63371: 54% mana arcane_charge(4), deathborne, lead_by_example
4:15.751 shared_cds { berserking Fluffy_Pillow 34529.3/63371: 54% mana arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:15.751 aoe o arcane_blast Fluffy_Pillow 34529.3/63371: 54% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:16.962 aoe o arcane_blast Fluffy_Pillow 32626.7/63371: 51% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:18.172 aoe o arcane_blast Fluffy_Pillow 30722.7/63371: 48% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:19.384 aoe o arcane_blast Fluffy_Pillow 28821.4/63371: 45% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:20.595 aoe n presence_of_mind Fluffy_Pillow 26918.7/63371: 42% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:20.595 aoe o arcane_blast Fluffy_Pillow 26918.7/63371: 42% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:21.783 aoe o arcane_blast Fluffy_Pillow 24986.9/63371: 39% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne, lead_by_example
4:22.972 aoe o arcane_blast Fluffy_Pillow 23056.4/63371: 36% mana berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, deathborne, lead_by_example
4:24.162 aoe o arcane_blast Fluffy_Pillow 21127.1/63371: 33% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:25.374 aoe o arcane_blast Fluffy_Pillow 19225.8/63371: 30% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:26.584 aoe o arcane_blast Fluffy_Pillow 17321.9/63371: 27% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:27.798 aoe m rune_of_power Fluffy_Pillow 15423.0/63371: 24% mana arcane_charge(4), arcane_power, clearcasting, deathborne, lead_by_example
4:29.102 aoe o arcane_blast Fluffy_Pillow 17075.7/63371: 27% mana arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, deathborne, lead_by_example
4:30.433 aoe o arcane_blast Fluffy_Pillow 15325.2/63371: 24% mana arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, deathborne, lead_by_example
4:31.764 aoe o arcane_blast Fluffy_Pillow 10137.1/63371: 16% mana arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example
4:33.098 aoe r arcane_barrage Fluffy_Pillow 4952.9/63371: 8% mana arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example
4:34.403 aoe o arcane_blast Fluffy_Pillow 9141.7/63371: 14% mana clearcasting(2), rune_of_power, deathborne, lead_by_example
4:36.362 aoe q arcane_explosion Fluffy_Pillow 10249.6/63371: 16% mana arcane_charge, clearcasting(2), rune_of_power, lead_by_example
4:37.669 aoe q arcane_explosion Fluffy_Pillow 11906.2/63371: 19% mana arcane_charge(2), clearcasting, rune_of_power, lead_by_example
4:38.974 aoe q arcane_explosion Fluffy_Pillow 13560.2/63371: 21% mana arcane_charge(3), rune_of_power, lead_by_example
4:40.280 aoe r arcane_barrage Fluffy_Pillow 10215.4/63371: 16% mana arcane_charge(4), rune_of_power, lead_by_example
4:41.586 aoe p arcane_orb Fluffy_Pillow 14405.5/63371: 23% mana lead_by_example
4:42.890 aoe r arcane_barrage Fluffy_Pillow 15558.3/63371: 25% mana arcane_charge(4), lead_by_example
4:44.195 aoe q arcane_explosion Fluffy_Pillow 19747.1/63371: 31% mana lead_by_example
4:45.501 aoe q arcane_explosion Fluffy_Pillow 16402.4/63371: 26% mana arcane_charge
4:46.808 aoe q arcane_explosion Fluffy_Pillow 13058.9/63371: 21% mana arcane_charge(2)
4:48.113 aoe q arcane_explosion Fluffy_Pillow 9712.9/63371: 15% mana arcane_charge(3), clearcasting
4:49.420 aoe r arcane_barrage Fluffy_Pillow 11369.4/63371: 18% mana arcane_charge(4)
4:50.727 aoe q arcane_explosion Fluffy_Pillow 15560.8/63371: 25% mana
4:52.034 aoe q arcane_explosion Fluffy_Pillow 12217.3/63371: 19% mana arcane_charge
4:53.338 aoe q arcane_explosion Fluffy_Pillow 8870.1/63371: 14% mana arcane_charge(2), clearcasting
4:54.646 aoe q arcane_explosion Fluffy_Pillow 10527.9/63371: 17% mana arcane_charge(3)
4:55.955 aoe r arcane_barrage Fluffy_Pillow 7186.9/63371: 11% mana arcane_charge(4)
4:57.260 aoe q arcane_explosion Fluffy_Pillow 11375.8/63371: 18% mana
4:58.565 aoe q arcane_explosion Fluffy_Pillow 8029.8/63371: 13% mana arcane_charge
4:59.873 aoe s evocation Fluffy_Pillow 4687.6/63371: 7% mana arcane_charge(2)
5:04.218 aoe q arcane_explosion Fluffy_Pillow 58533.5/63371: 92% mana arcane_charge(2)
5:05.525 aoe q arcane_explosion Fluffy_Pillow 55190.0/63371: 87% mana arcane_charge(3), clearcasting
5:06.831 aoe r arcane_barrage Fluffy_Pillow 56845.3/63371: 90% mana arcane_charge(4)
5:08.137 aoe p arcane_orb Fluffy_Pillow 61035.4/63371: 96% mana
5:09.444 aoe r arcane_barrage Fluffy_Pillow 62191.9/63371: 98% mana arcane_charge(4)
5:10.750 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
5:12.056 aoe q arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge
5:13.362 aoe k touch_of_the_magi Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), clearcasting
5:14.668 aoe m rune_of_power Fluffy_Pillow 55837.2/63371: 88% mana arcane_charge(4), clearcasting
5:15.974 aoe r arcane_barrage Fluffy_Pillow 57492.5/63371: 91% mana arcane_charge(4), clearcasting, rune_of_power
5:17.282 aoe q arcane_explosion Fluffy_Pillow 61685.1/63371: 97% mana clearcasting, rune_of_power
5:18.590 aoe q arcane_explosion Fluffy_Pillow 63342.9/63371: 100% mana arcane_charge, rune_of_power
5:19.897 aoe q arcane_explosion Fluffy_Pillow 59999.5/63371: 95% mana arcane_charge(2), rune_of_power
5:21.202 aoe q arcane_explosion Fluffy_Pillow 56653.4/63371: 89% mana arcane_charge(3), rune_of_power
5:22.509 aoe r arcane_barrage Fluffy_Pillow 53310.0/63371: 84% mana arcane_charge(4), rune_of_power
5:23.816 aoe q arcane_explosion Fluffy_Pillow 57501.4/63371: 91% mana rune_of_power
5:25.123 aoe q arcane_explosion Fluffy_Pillow 54157.9/63371: 85% mana arcane_charge, rune_of_power
5:26.430 aoe q arcane_explosion Fluffy_Pillow 50814.4/63371: 80% mana arcane_charge(2), clearcasting, rune_of_power
5:27.737 aoe q arcane_explosion Fluffy_Pillow 52471.0/63371: 83% mana arcane_charge(3), rune_of_power
5:29.044 aoe r arcane_barrage Fluffy_Pillow 49127.5/63371: 78% mana arcane_charge(4)
5:30.351 aoe p arcane_orb Fluffy_Pillow 53318.9/63371: 84% mana
5:31.656 aoe r arcane_barrage Fluffy_Pillow 54472.9/63371: 86% mana arcane_charge(4)
5:32.963 aoe q arcane_explosion Fluffy_Pillow 58664.2/63371: 93% mana
5:34.270 aoe q arcane_explosion Fluffy_Pillow 55320.8/63371: 87% mana arcane_charge
5:35.577 aoe q arcane_explosion Fluffy_Pillow 51977.3/63371: 82% mana arcane_charge(2)
5:36.885 aoe q arcane_explosion Fluffy_Pillow 48635.1/63371: 77% mana arcane_charge(3)
5:38.193 aoe r arcane_barrage Fluffy_Pillow 45292.9/63371: 71% mana arcane_charge(4)
5:39.500 aoe q arcane_explosion Fluffy_Pillow 49484.3/63371: 78% mana
5:40.807 aoe q arcane_explosion Fluffy_Pillow 46140.8/63371: 73% mana arcane_charge
5:42.114 aoe q arcane_explosion Fluffy_Pillow 42797.3/63371: 68% mana arcane_charge(2)
5:43.420 aoe q arcane_explosion Fluffy_Pillow 39452.6/63371: 62% mana arcane_charge(3)
5:44.726 aoe r arcane_barrage Fluffy_Pillow 36107.9/63371: 57% mana arcane_charge(4)
5:46.032 aoe q arcane_explosion Fluffy_Pillow 40298.0/63371: 64% mana
5:47.339 aoe q arcane_explosion Fluffy_Pillow 36954.5/63371: 58% mana arcane_charge, clearcasting
5:48.646 aoe q arcane_explosion Fluffy_Pillow 38611.0/63371: 61% mana arcane_charge(2)
5:49.952 aoe q arcane_explosion Fluffy_Pillow 35266.3/63371: 56% mana arcane_charge(3)
5:51.259 aoe r arcane_barrage Fluffy_Pillow 31922.8/63371: 50% mana arcane_charge(4)
5:52.564 aoe p arcane_orb Fluffy_Pillow 36111.7/63371: 57% mana
5:53.871 aoe r arcane_barrage Fluffy_Pillow 37268.2/63371: 59% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Emeni"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=342156//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Marileth : 11182 dps, 4905 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11182.0 11182.0 20.1 / 0.180% 1315.0 / 11.8% 5.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
2182.0 2069.9 Mana 0.00% 49.3 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Marileth 11182
Arcane Barrage 3104 27.7% 49.5 5.65sec 18775 14669 Direct 148.3 5259 10500 6269 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.50 148.28 0.00 0.00 1.2799 0.0000 929420.72 929420.72 0.00% 14668.89 14668.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 119.71 86 154 5259.18 1153 27654 5262.17 4715 5999 629357 629357 0.00%
crit 19.27% 28.57 12 53 10500.14 2307 55308 10517.20 6891 16173 300064 300064 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:49.31
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.01
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
    rotation
    [x]:0.18
Arcane Blast 2669 24.0% 30.0 8.02sec 26781 24934 Direct 86.6 7769 15513 9270 19.4%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.98 86.59 0.00 0.00 1.0741 0.0000 802845.17 802845.17 0.00% 24933.85 24933.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 69.81 33 90 7768.91 1177 12036 7775.63 6506 8462 542445 542445 0.00%
crit 19.38% 16.78 1 32 15512.72 2355 24073 15516.05 11425 20373 260400 260400 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    aoe
    [o]:30.08
  • if_expr:buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
    rotation
    [w]:0.08
Arcane Echo 252 2.3% 38.2 7.33sec 1975 0 Direct 114.7 552 1103 658 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.22 114.66 0.00 0.00 0.0000 0.0000 75477.51 75477.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 92.53 60 120 551.93 443 731 551.58 507 589 51061 51061 0.00%
crit 19.30% 22.13 8 37 1103.39 886 1462 1102.76 886 1318 24417 24417 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 3484 31.1% 128.2 2.13sec 8134 6365 Direct 384.7 2272 4541 2711 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 128.24 384.72 0.00 0.00 1.2778 0.0000 1043043.52 1043043.52 0.00% 6365.03 6365.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 310.30 240 394 2272.30 1958 4112 2273.85 2202 2366 705135 705135 0.00%
crit 19.34% 74.42 43 114 4540.62 3916 8223 4543.74 4136 5011 337908 337908 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:128.21
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (678) 0.0% (6.1%) 11.7 24.65sec 17434 13613

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.65 0.00 0.00 0.00 1.2808 0.0000 0.00 0.00 0.00% 13612.88 13612.88

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:11.63
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [v]:0.02
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 678 6.1% 34.9 24.66sec 5821 0 Direct 34.9 4881 9749 5823 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.90 34.90 0.00 0.00 0.0000 0.0000 203117.85 203117.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 28.16 18 40 4881.28 3869 8126 4885.42 4035 5367 137390 137390 0.00%
crit 19.31% 6.74 0 16 9749.49 7739 16251 9763.08 0 13543 65728 65728 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (64) 0.0% (0.6%) 13.6 1.79sec 1384 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.61 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 64 0.6% 13.6 1.79sec 1384 0 Direct 13.6 1164 2327 1384 19.0%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.61 13.61 0.00 0.00 0.0000 0.0000 18843.09 18843.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.05% 11.03 4 19 1163.53 1164 1164 1163.53 1164 1164 12839 12839 0.00%
crit 18.95% 2.58 0 9 2327.06 2327 2327 2198.95 0 2327 6004 6004 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1777 20.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1778.76 1778.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.87% 0.80 0 1 1480.68 1481 1481 1182.59 0 1481 1183 1183 0.00%
crit 20.13% 0.20 0 1 2961.35 2961 2961 596.16 0 2961 596 596 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5783 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.2% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5782.71 5782.71 0.00% 49.10 49.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 72.79 61 84 53.92 43 60 53.92 53 56 3925 3925 0.00%
crit 19.12% 17.21 6 29 107.97 86 120 107.98 96 120 1858 1858 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (906) 0.0% (8.1%) 6.2 51.35sec 43394 34486

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.24 0.00 0.00 0.00 1.2585 0.0000 0.00 0.00 0.00% 34485.73 34485.73

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.26
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 906 8.1% 6.2 51.25sec 43394 0 Direct 18.6 14544 0 14544 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.24 18.65 0.00 0.00 0.0000 0.0000 270919.91 270919.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.65 15 21 14543.91 2506 63871 14555.25 10053 20486 270920 270920 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16809.58
  • base_dd_max:16809.58
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Marileth
Arcane Power 2.9 126.37sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.86
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 253.08sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [{]:1.86
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.9 253.33sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.87 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.88
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 2.1 175.95sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 12.32 0.00 3.8883 0.6520 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:2.07
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [z]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.8 251.82sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.82 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.82
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
    cooldowns
    [t]:0.00
  • if_expr:debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Rune of Power 6.1 50.08sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.11 0.00 0.00 0.00 1.2574 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.13
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.9 120.90sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [y]:2.94
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.2 160.8 6.0sec 1.4sec 4.5sec 75.85% 0.00% 29.9 (30.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 30.9s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.6s

Stack Uptimes

  • arcane_charge_1:16.98%
  • arcane_charge_2:14.55%
  • arcane_charge_3:15.01%
  • arcane_charge_4:29.32%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 126.4sec 126.4sec 14.7sec 14.01% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.8s / 138.0s
  • trigger_min/max:120.8s / 138.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:14.01%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 253.1sec 253.1sec 11.7sec 7.21% 32.68% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:249.8s / 262.6s
  • trigger_min/max:249.8s / 262.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:7.21%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.3 3.7 13.1sec 11.3sec 3.3sec 24.09% 0.00% 1.2 (1.2) 0.3

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:17.92%
  • clearcasting_2:3.02%
  • clearcasting_3:3.15%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.9 0.0 253.4sec 253.4sec 19.1sec 11.83% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:249.5s / 262.3s
  • trigger_min/max:249.5s / 262.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 20.0s

Stack Uptimes

  • deathborne_1:11.83%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 2.1 0.0 173.0sec 173.0sec 3.9sec 2.67% 0.00% 8.2 (8.2) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.0s / 298.8s
  • trigger_min/max:90.0s / 298.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:2.67%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.8 0.0 251.4sec 251.4sec 2.2sec 1.34% 18.05% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:63.4s / 259.0s
  • trigger_min/max:63.4s / 259.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 145.2s

Stack Uptimes

  • presence_of_mind_1:0.63%
  • presence_of_mind_2:0.66%
  • presence_of_mind_3:0.05%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 9.0 0.0 34.4sec 34.4sec 11.8sec 35.26% 0.00% 0.0 (0.0) 8.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 52.9s
  • trigger_min/max:13.1s / 52.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.26%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.05% 0.00% 4.26%
Arcane Barrage Arcane Charge 2 0.11% 0.00% 5.88%
Arcane Barrage Arcane Charge 3 0.19% 0.00% 6.90%
Arcane Barrage Arcane Charge 4 99.65% 90.74% 100.00%
Arcane Blast Arcane Charge 0 1.37% 0.00% 6.67%
Arcane Blast Arcane Charge 1 0.92% 0.00% 9.52%
Arcane Blast Arcane Charge 2 0.72% 0.00% 8.11%
Arcane Blast Arcane Charge 3 0.57% 0.00% 6.67%
Arcane Blast Arcane Charge 4 96.43% 73.33% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 0.47% 0.14% 3.32% 0.7s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.091120.122239.871
Evocation61.5210.000208.832149.25965.105246.485
Rune of Power5.5270.00022.61634.99618.31651.911
Touch of the Magi4.4500.00023.91629.03617.24768.879
Arcane Power4.9690.77218.03314.6093.10124.937
Arcane Barrage3.4760.00228.281174.338133.882212.541
Arcane Orb6.1970.00035.01974.45848.43699.662
Deathborne33.5080.00081.02371.32858.82081.023
Presence of Mind90.1471.038197.134202.17578.192235.670

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Marileth
mana_regen Mana 827.90 377478.18 60.77% 455.94 2297.07 0.60%
Evocation Mana 90.01 100382.24 16.16% 1115.27 0.00 0.00%
Mana Gem Mana 2.94 18636.24 3.00% 6337.14 0.00 0.00%
Arcane Barrage Mana 49.50 124620.71 20.06% 2517.65 659.41 0.53%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 2069.89 2182.02 2954.4 29723.3 158.7 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Marileth
arcane_blast Mana 30.0 125259.4 4173.7 4178.4 6.4
arcane_explosion Mana 128.2 502583.1 3919.9 3919.1 2.1
arcane_orb Mana 11.6 5574.6 478.6 478.5 36.4
deathborne Mana 1.9 4673.6 2500.0 2502.3 0.0
touch_of_the_magi Mana 6.2 15600.2 2500.0 2498.7 17.4

Statistics & Data Analysis

Fight Length
Necrolord_Marileth Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Necrolord_Marileth Damage Per Second
Count 1217
Mean 11182.00
Minimum 10232.30
Maximum 12165.18
Spread ( max - min ) 1932.88
Range [ ( max - min ) / 2 * 100% ] 8.64%
Standard Deviation 358.2746
5th Percentile 10637.47
95th Percentile 11807.39
( 95th Percentile - 5th Percentile ) 1169.91
Mean Distribution
Standard Deviation 10.2700
95.00% Confidence Interval ( 11161.88 - 11202.13 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3944
0.1 Scale Factor Error with Delta=300 1096
0.05 Scale Factor Error with Delta=300 4384
0.01 Scale Factor Error with Delta=300 109577
Priority Target DPS
Necrolord_Marileth Priority Target Damage Per Second
Count 1217
Mean 4904.61
Minimum 4365.23
Maximum 5534.69
Spread ( max - min ) 1169.46
Range [ ( max - min ) / 2 * 100% ] 11.92%
Standard Deviation 197.1822
5th Percentile 4602.75
95th Percentile 5244.05
( 95th Percentile - 5th Percentile ) 641.30
Mean Distribution
Standard Deviation 5.6523
95.00% Confidence Interval ( 4893.53 - 4915.68 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 63
0.1% Error 6210
0.1 Scale Factor Error with Delta=300 332
0.05 Scale Factor Error with Delta=300 1328
0.01 Scale Factor Error with Delta=300 33191
DPS(e)
Necrolord_Marileth Damage Per Second (Effective)
Count 1217
Mean 11182.00
Minimum 10232.30
Maximum 12165.18
Spread ( max - min ) 1932.88
Range [ ( max - min ) / 2 * 100% ] 8.64%
Damage
Necrolord_Marileth Damage
Count 1217
Mean 3345446.52
Minimum 2560967.04
Maximum 4014304.06
Spread ( max - min ) 1453337.02
Range [ ( max - min ) / 2 * 100% ] 21.72%
DTPS
Necrolord_Marileth Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Marileth Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Marileth Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Marileth Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Marileth Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Marileth Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_MarilethTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Marileth Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.88 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.26 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.86 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.13 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.82 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
o 30.08 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 11.63 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 128.21 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 49.31 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 2.07 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
u 0.01 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
v 0.02 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
w 0.08 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
x 0.18 arcane_barrage
actions.shared_cds
# count action,conditions
y 2.94 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
z 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
{ 1.86 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklz{oooyooonooooooomoooooorprqqqqrqqqqrqqqqrqqqqrprqqqqrqqskmrprqqqqrqqqqrqqqqrprqqqqrqqqqrqqqqrkmrprqqqqrqqyqqlrqqqqrprqqqqrqqqqrqqqqrkmrprqqqqrqqqqrqqqqrprqqqqrqqqqrqqqqrkmrprqqqqrqqqqrqqsqqrprqqqqrqqqyqrkjl{ooonooooooomooooorprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqsqqrpr

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.308 aoe k touch_of_the_magi Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, deathborne
0:02.313 aoe l arcane_power Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), deathborne
0:02.313 shared_cds z potion Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne
0:02.313 shared_cds { berserking Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:02.313 aoe o arcane_blast Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:03.246 aoe o arcane_blast Fluffy_Pillow 57397.8/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:04.179 aoe o arcane_blast Fluffy_Pillow 55142.8/63371: 87% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.111 shared_cds y use_mana_gem Necrolord_Marileth 52886.6/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.111 aoe o arcane_blast Fluffy_Pillow 59223.7/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.045 aoe o arcane_blast Fluffy_Pillow 56970.0/63371: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.978 aoe o arcane_blast Fluffy_Pillow 54715.0/63371: 86% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:07.912 aoe n presence_of_mind Fluffy_Pillow 52461.3/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:07.912 aoe o arcane_blast Fluffy_Pillow 52461.3/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:08.826 aoe o arcane_blast Fluffy_Pillow 50182.2/63371: 79% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(2), rune_of_power, deathborne, potion_of_deathly_fixation
0:09.741 aoe o arcane_blast Fluffy_Pillow 47904.4/63371: 76% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind, rune_of_power, deathborne, potion_of_deathly_fixation
0:10.655 aoe o arcane_blast Fluffy_Pillow 45625.3/63371: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:11.587 aoe o arcane_blast Fluffy_Pillow 43369.1/63371: 68% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:12.520 aoe o arcane_blast Fluffy_Pillow 41114.1/63371: 65% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:13.455 aoe o arcane_blast Fluffy_Pillow 38861.6/63371: 61% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:14.387 aoe m rune_of_power Fluffy_Pillow 36605.4/63371: 58% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(2), deathborne, potion_of_deathly_fixation
0:15.395 aoe o arcane_blast Fluffy_Pillow 37882.9/63371: 60% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:16.421 aoe o arcane_blast Fluffy_Pillow 35745.8/63371: 56% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:17.449 aoe o arcane_blast Fluffy_Pillow 30173.7/63371: 48% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:18.475 aoe o arcane_blast Fluffy_Pillow 24599.1/63371: 39% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:19.502 aoe o arcane_blast Fluffy_Pillow 19025.8/63371: 30% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:20.529 aoe o arcane_blast Fluffy_Pillow 13452.4/63371: 21% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:21.557 aoe r arcane_barrage Fluffy_Pillow 7880.3/63371: 12% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, potion_of_deathly_fixation
0:22.564 aoe p arcane_orb Fluffy_Pillow 11691.5/63371: 18% mana bloodlust, clearcasting(3), rune_of_power, potion_of_deathly_fixation
0:23.568 aoe r arcane_barrage Fluffy_Pillow 12464.0/63371: 20% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, potion_of_deathly_fixation
0:24.573 aoe q arcane_explosion Fluffy_Pillow 16272.6/63371: 26% mana bloodlust, clearcasting(3), rune_of_power, potion_of_deathly_fixation
0:25.580 aoe q arcane_explosion Fluffy_Pillow 17548.9/63371: 28% mana bloodlust, arcane_charge, clearcasting(2), rune_of_power, potion_of_deathly_fixation
0:26.586 aoe q arcane_explosion Fluffy_Pillow 18823.9/63371: 30% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.592 aoe q arcane_explosion Fluffy_Pillow 20099.0/63371: 32% mana bloodlust, arcane_charge(3)
0:28.600 aoe r arcane_barrage Fluffy_Pillow 16376.6/63371: 26% mana bloodlust, arcane_charge(4), clearcasting
0:29.607 aoe q arcane_explosion Fluffy_Pillow 20187.7/63371: 32% mana bloodlust, clearcasting
0:30.616 aoe q arcane_explosion Fluffy_Pillow 21466.5/63371: 34% mana bloodlust, arcane_charge
0:31.621 aoe q arcane_explosion Fluffy_Pillow 17740.3/63371: 28% mana bloodlust, arcane_charge(2), clearcasting
0:32.627 aoe q arcane_explosion Fluffy_Pillow 19015.3/63371: 30% mana bloodlust, arcane_charge(3)
0:33.634 aoe r arcane_barrage Fluffy_Pillow 15291.6/63371: 24% mana bloodlust, arcane_charge(4)
0:34.641 aoe q arcane_explosion Fluffy_Pillow 19102.8/63371: 30% mana bloodlust
0:35.646 aoe q arcane_explosion Fluffy_Pillow 15376.6/63371: 24% mana bloodlust, arcane_charge, clearcasting
0:36.652 aoe q arcane_explosion Fluffy_Pillow 16651.6/63371: 26% mana bloodlust, arcane_charge(2)
0:37.659 aoe q arcane_explosion Fluffy_Pillow 12927.9/63371: 20% mana bloodlust, arcane_charge(3), clearcasting
0:38.667 aoe r arcane_barrage Fluffy_Pillow 14205.5/63371: 22% mana bloodlust, arcane_charge(4)
0:39.673 aoe q arcane_explosion Fluffy_Pillow 18015.4/63371: 28% mana bloodlust
0:40.679 aoe q arcane_explosion Fluffy_Pillow 14290.4/63371: 23% mana bloodlust, arcane_charge, clearcasting
0:41.685 aoe q arcane_explosion Fluffy_Pillow 15565.4/63371: 25% mana arcane_charge(2)
0:42.992 aoe q arcane_explosion Fluffy_Pillow 12222.0/63371: 19% mana arcane_charge(3)
0:44.298 aoe r arcane_barrage Fluffy_Pillow 8877.2/63371: 14% mana arcane_charge(4)
0:45.605 aoe p arcane_orb Fluffy_Pillow 13068.6/63371: 21% mana
0:46.912 aoe r arcane_barrage Fluffy_Pillow 14225.1/63371: 22% mana arcane_charge(4)
0:48.217 aoe q arcane_explosion Fluffy_Pillow 18414.0/63371: 29% mana
0:49.522 aoe q arcane_explosion Fluffy_Pillow 15068.0/63371: 24% mana arcane_charge
0:50.829 aoe q arcane_explosion Fluffy_Pillow 11724.5/63371: 19% mana arcane_charge(2)
0:52.135 aoe q arcane_explosion Fluffy_Pillow 8379.8/63371: 13% mana arcane_charge(3)
0:53.441 aoe r arcane_barrage Fluffy_Pillow 5035.0/63371: 8% mana arcane_charge(4)
0:54.747 aoe q arcane_explosion Fluffy_Pillow 9225.1/63371: 15% mana
0:56.053 aoe q arcane_explosion Fluffy_Pillow 5880.4/63371: 9% mana arcane_charge
0:57.360 aoe s evocation Necrolord_Marileth 2536.9/63371: 4% mana arcane_charge(2)
1:01.703 aoe k touch_of_the_magi Fluffy_Pillow 56380.3/63371: 89% mana arcane_charge(2)
1:03.009 aoe m rune_of_power Fluffy_Pillow 55535.6/63371: 88% mana arcane_charge(4)
1:04.316 aoe r arcane_barrage Fluffy_Pillow 57192.1/63371: 90% mana arcane_charge(4), rune_of_power
1:05.623 aoe p arcane_orb Fluffy_Pillow 61383.5/63371: 97% mana rune_of_power
1:06.930 aoe r arcane_barrage Fluffy_Pillow 62540.0/63371: 99% mana arcane_charge(4), rune_of_power
1:08.236 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
1:09.543 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, rune_of_power
1:10.850 aoe q arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), rune_of_power
1:12.157 aoe q arcane_explosion Fluffy_Pillow 53341.0/63371: 84% mana arcane_charge(3), rune_of_power
1:13.462 aoe r arcane_barrage Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4), rune_of_power
1:14.769 aoe q arcane_explosion Fluffy_Pillow 54186.4/63371: 86% mana rune_of_power
1:16.077 aoe q arcane_explosion Fluffy_Pillow 50844.2/63371: 80% mana arcane_charge, rune_of_power
1:17.383 aoe q arcane_explosion Fluffy_Pillow 47499.5/63371: 75% mana arcane_charge(2), clearcasting
1:18.689 aoe q arcane_explosion Fluffy_Pillow 49154.7/63371: 78% mana arcane_charge(3)
1:19.994 aoe r arcane_barrage Fluffy_Pillow 45808.7/63371: 72% mana arcane_charge(4)
1:21.300 aoe q arcane_explosion Fluffy_Pillow 49998.8/63371: 79% mana
1:22.605 aoe q arcane_explosion Fluffy_Pillow 46652.8/63371: 74% mana arcane_charge
1:23.911 aoe q arcane_explosion Fluffy_Pillow 43308.1/63371: 68% mana arcane_charge(2)
1:25.217 aoe q arcane_explosion Fluffy_Pillow 39963.3/63371: 63% mana arcane_charge(3)
1:26.522 aoe r arcane_barrage Fluffy_Pillow 36617.3/63371: 58% mana arcane_charge(4)
1:27.830 aoe p arcane_orb Fluffy_Pillow 40810.0/63371: 64% mana
1:29.137 aoe r arcane_barrage Fluffy_Pillow 41966.5/63371: 66% mana arcane_charge(4)
1:30.445 aoe q arcane_explosion Fluffy_Pillow 46159.2/63371: 73% mana
1:31.751 aoe q arcane_explosion Fluffy_Pillow 42814.4/63371: 68% mana arcane_charge
1:33.056 aoe q arcane_explosion Fluffy_Pillow 39468.4/63371: 62% mana arcane_charge(2)
1:34.361 aoe q arcane_explosion Fluffy_Pillow 36122.4/63371: 57% mana arcane_charge(3), clearcasting
1:35.668 aoe r arcane_barrage Fluffy_Pillow 37779.0/63371: 60% mana arcane_charge(4)
1:36.975 aoe q arcane_explosion Fluffy_Pillow 41970.3/63371: 66% mana
1:38.282 aoe q arcane_explosion Fluffy_Pillow 38626.9/63371: 61% mana arcane_charge
1:39.588 aoe q arcane_explosion Fluffy_Pillow 35282.1/63371: 56% mana arcane_charge(2)
1:40.895 aoe q arcane_explosion Fluffy_Pillow 31938.7/63371: 50% mana arcane_charge(3)
1:42.203 aoe r arcane_barrage Fluffy_Pillow 28596.5/63371: 45% mana arcane_charge(4)
1:43.509 aoe q arcane_explosion Fluffy_Pillow 32786.6/63371: 52% mana
1:44.815 aoe q arcane_explosion Fluffy_Pillow 29441.8/63371: 46% mana arcane_charge
1:46.121 aoe q arcane_explosion Fluffy_Pillow 26097.1/63371: 41% mana arcane_charge(2)
1:47.426 aoe q arcane_explosion Fluffy_Pillow 22751.1/63371: 36% mana arcane_charge(3), clearcasting
1:48.733 aoe r arcane_barrage Fluffy_Pillow 24407.6/63371: 39% mana arcane_charge(4)
1:50.038 aoe k touch_of_the_magi Fluffy_Pillow 28596.5/63371: 45% mana
1:51.347 aoe m rune_of_power Fluffy_Pillow 27755.5/63371: 44% mana arcane_charge(4)
1:52.652 aoe r arcane_barrage Fluffy_Pillow 29409.5/63371: 46% mana arcane_charge(4), rune_of_power
1:53.959 aoe p arcane_orb Fluffy_Pillow 33600.9/63371: 53% mana rune_of_power
1:55.265 aoe r arcane_barrage Fluffy_Pillow 34756.2/63371: 55% mana arcane_charge(4), rune_of_power
1:56.573 aoe q arcane_explosion Fluffy_Pillow 38948.8/63371: 61% mana rune_of_power
1:57.881 aoe q arcane_explosion Fluffy_Pillow 35606.6/63371: 56% mana arcane_charge, rune_of_power
1:59.187 aoe q arcane_explosion Fluffy_Pillow 32261.9/63371: 51% mana arcane_charge(2), rune_of_power
2:00.494 aoe q arcane_explosion Fluffy_Pillow 28918.4/63371: 46% mana arcane_charge(3), rune_of_power
2:01.799 aoe r arcane_barrage Fluffy_Pillow 25572.4/63371: 40% mana arcane_charge(4), rune_of_power
2:03.106 aoe q arcane_explosion Fluffy_Pillow 29763.8/63371: 47% mana rune_of_power
2:04.413 aoe q arcane_explosion Fluffy_Pillow 26420.3/63371: 42% mana arcane_charge, rune_of_power
2:05.720 shared_cds y use_mana_gem Necrolord_Marileth 23076.9/63371: 36% mana arcane_charge(2)
2:05.720 aoe q arcane_explosion Fluffy_Pillow 29414.0/63371: 46% mana arcane_charge(2)
2:07.025 aoe q arcane_explosion Fluffy_Pillow 26068.0/63371: 41% mana arcane_charge(3)
2:08.333 aoe l arcane_power Fluffy_Pillow 22725.8/63371: 36% mana arcane_charge(4), clearcasting
2:08.333 aoe r arcane_barrage Fluffy_Pillow 22725.8/63371: 36% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
2:09.640 aoe q arcane_explosion Fluffy_Pillow 26917.2/63371: 42% mana arcane_power, clearcasting, rune_of_power
2:10.947 aoe q arcane_explosion Fluffy_Pillow 28573.7/63371: 45% mana arcane_charge, arcane_power, rune_of_power
2:12.252 aoe q arcane_explosion Fluffy_Pillow 27727.7/63371: 44% mana arcane_charge(2), arcane_power, rune_of_power
2:13.558 aoe q arcane_explosion Fluffy_Pillow 26883.0/63371: 42% mana arcane_charge(3), arcane_power, rune_of_power
2:14.865 aoe r arcane_barrage Fluffy_Pillow 26039.5/63371: 41% mana arcane_charge(4), arcane_power, rune_of_power
2:16.171 aoe p arcane_orb Fluffy_Pillow 30229.6/63371: 48% mana arcane_power, rune_of_power
2:17.478 aoe r arcane_barrage Fluffy_Pillow 31636.1/63371: 50% mana arcane_charge(4), arcane_power, rune_of_power
2:18.785 aoe q arcane_explosion Fluffy_Pillow 35827.5/63371: 57% mana arcane_power, rune_of_power
2:20.092 aoe q arcane_explosion Fluffy_Pillow 34984.1/63371: 55% mana arcane_charge, arcane_power, rune_of_power
2:21.397 aoe q arcane_explosion Fluffy_Pillow 34138.1/63371: 54% mana arcane_charge(2), arcane_power
2:22.703 aoe q arcane_explosion Fluffy_Pillow 33293.3/63371: 53% mana arcane_charge(3), arcane_power
2:24.011 aoe r arcane_barrage Fluffy_Pillow 32451.1/63371: 51% mana arcane_charge(4)
2:25.316 aoe q arcane_explosion Fluffy_Pillow 36640.0/63371: 58% mana
2:26.623 aoe q arcane_explosion Fluffy_Pillow 33296.5/63371: 53% mana arcane_charge
2:27.931 aoe q arcane_explosion Fluffy_Pillow 29954.3/63371: 47% mana arcane_charge(2), clearcasting
2:29.237 aoe q arcane_explosion Fluffy_Pillow 31609.6/63371: 50% mana arcane_charge(3)
2:30.542 aoe r arcane_barrage Fluffy_Pillow 28263.5/63371: 45% mana arcane_charge(4)
2:31.849 aoe q arcane_explosion Fluffy_Pillow 32454.9/63371: 51% mana
2:33.153 aoe q arcane_explosion Fluffy_Pillow 29107.7/63371: 46% mana arcane_charge
2:34.459 aoe q arcane_explosion Fluffy_Pillow 25762.9/63371: 41% mana arcane_charge(2)
2:35.766 aoe q arcane_explosion Fluffy_Pillow 22419.5/63371: 35% mana arcane_charge(3)
2:37.071 aoe r arcane_barrage Fluffy_Pillow 19073.4/63371: 30% mana arcane_charge(4)
2:38.379 aoe k touch_of_the_magi Fluffy_Pillow 23266.1/63371: 37% mana
2:39.687 aoe m rune_of_power Fluffy_Pillow 22423.9/63371: 35% mana arcane_charge(4)
2:40.993 aoe r arcane_barrage Fluffy_Pillow 24079.2/63371: 38% mana arcane_charge(4), rune_of_power
2:42.300 aoe p arcane_orb Fluffy_Pillow 28270.5/63371: 45% mana rune_of_power
2:43.606 aoe r arcane_barrage Fluffy_Pillow 29425.8/63371: 46% mana arcane_charge(4), rune_of_power
2:44.912 aoe q arcane_explosion Fluffy_Pillow 33615.9/63371: 53% mana rune_of_power
2:46.219 aoe q arcane_explosion Fluffy_Pillow 30272.5/63371: 48% mana arcane_charge, rune_of_power
2:47.527 aoe q arcane_explosion Fluffy_Pillow 26930.3/63371: 42% mana arcane_charge(2), rune_of_power
2:48.832 aoe q arcane_explosion Fluffy_Pillow 23584.2/63371: 37% mana arcane_charge(3), clearcasting, rune_of_power
2:50.138 aoe r arcane_barrage Fluffy_Pillow 25239.5/63371: 40% mana arcane_charge(4), rune_of_power
2:51.443 aoe q arcane_explosion Fluffy_Pillow 29428.4/63371: 46% mana rune_of_power
2:52.750 aoe q arcane_explosion Fluffy_Pillow 26084.9/63371: 41% mana arcane_charge, rune_of_power
2:54.056 aoe q arcane_explosion Fluffy_Pillow 22740.1/63371: 36% mana arcane_charge(2)
2:55.363 aoe q arcane_explosion Fluffy_Pillow 19396.7/63371: 31% mana arcane_charge(3)
2:56.669 aoe r arcane_barrage Fluffy_Pillow 16051.9/63371: 25% mana arcane_charge(4), clearcasting
2:57.975 aoe q arcane_explosion Fluffy_Pillow 20242.1/63371: 32% mana clearcasting
2:59.281 aoe q arcane_explosion Fluffy_Pillow 21897.3/63371: 35% mana arcane_charge
3:00.586 aoe q arcane_explosion Fluffy_Pillow 18551.3/63371: 29% mana arcane_charge(2), clearcasting
3:01.893 aoe q arcane_explosion Fluffy_Pillow 20207.8/63371: 32% mana arcane_charge(3)
3:03.201 aoe r arcane_barrage Fluffy_Pillow 16865.6/63371: 27% mana arcane_charge(4)
3:04.507 aoe p arcane_orb Fluffy_Pillow 21055.8/63371: 33% mana
3:05.814 aoe r arcane_barrage Fluffy_Pillow 22212.3/63371: 35% mana arcane_charge(4)
3:07.119 aoe q arcane_explosion Fluffy_Pillow 26401.1/63371: 42% mana
3:08.426 aoe q arcane_explosion Fluffy_Pillow 23057.7/63371: 36% mana arcane_charge
3:09.731 aoe q arcane_explosion Fluffy_Pillow 19711.7/63371: 31% mana arcane_charge(2), clearcasting
3:11.036 aoe q arcane_explosion Fluffy_Pillow 21365.7/63371: 34% mana arcane_charge(3)
3:12.341 aoe r arcane_barrage Fluffy_Pillow 18019.7/63371: 28% mana arcane_charge(4)
3:13.646 aoe q arcane_explosion Fluffy_Pillow 22208.5/63371: 35% mana
3:14.952 aoe q arcane_explosion Fluffy_Pillow 18863.8/63371: 30% mana arcane_charge
3:16.259 aoe q arcane_explosion Fluffy_Pillow 15520.3/63371: 24% mana arcane_charge(2)
3:17.564 aoe q arcane_explosion Fluffy_Pillow 12174.3/63371: 19% mana arcane_charge(3)
3:18.871 aoe r arcane_barrage Fluffy_Pillow 8830.8/63371: 14% mana arcane_charge(4)
3:20.178 aoe q arcane_explosion Fluffy_Pillow 13022.2/63371: 21% mana
3:21.484 aoe q arcane_explosion Fluffy_Pillow 9677.5/63371: 15% mana arcane_charge, clearcasting
3:22.789 aoe q arcane_explosion Fluffy_Pillow 11331.5/63371: 18% mana arcane_charge(2)
3:24.097 aoe q arcane_explosion Fluffy_Pillow 7989.3/63371: 13% mana arcane_charge(3), clearcasting
3:25.402 aoe r arcane_barrage Fluffy_Pillow 9643.3/63371: 15% mana arcane_charge(4)
3:26.708 aoe k touch_of_the_magi Fluffy_Pillow 13833.4/63371: 22% mana
3:28.016 aoe m rune_of_power Fluffy_Pillow 12991.2/63371: 21% mana arcane_charge(4)
3:29.323 aoe r arcane_barrage Fluffy_Pillow 14647.7/63371: 23% mana arcane_charge(4), rune_of_power
3:30.632 aoe p arcane_orb Fluffy_Pillow 18841.6/63371: 30% mana rune_of_power
3:31.939 aoe r arcane_barrage Fluffy_Pillow 19998.1/63371: 32% mana arcane_charge(4), rune_of_power
3:33.244 aoe q arcane_explosion Fluffy_Pillow 24187.0/63371: 38% mana rune_of_power
3:34.550 aoe q arcane_explosion Fluffy_Pillow 20842.3/63371: 33% mana arcane_charge, clearcasting, rune_of_power
3:35.854 aoe q arcane_explosion Fluffy_Pillow 22495.0/63371: 35% mana arcane_charge(2), rune_of_power
3:37.161 aoe q arcane_explosion Fluffy_Pillow 19151.5/63371: 30% mana arcane_charge(3), rune_of_power
3:38.470 aoe r arcane_barrage Fluffy_Pillow 15810.6/63371: 25% mana arcane_charge(4), rune_of_power
3:39.775 aoe q arcane_explosion Fluffy_Pillow 19999.4/63371: 32% mana rune_of_power
3:41.080 aoe q arcane_explosion Fluffy_Pillow 16653.4/63371: 26% mana arcane_charge, rune_of_power
3:42.385 aoe q arcane_explosion Fluffy_Pillow 13307.4/63371: 21% mana arcane_charge(2)
3:43.690 aoe q arcane_explosion Fluffy_Pillow 9961.4/63371: 16% mana arcane_charge(3)
3:44.997 aoe r arcane_barrage Fluffy_Pillow 6617.9/63371: 10% mana arcane_charge(4)
3:46.303 aoe q arcane_explosion Fluffy_Pillow 10808.1/63371: 17% mana
3:47.607 aoe q arcane_explosion Fluffy_Pillow 7460.8/63371: 12% mana arcane_charge
3:48.912 aoe s evocation Fluffy_Pillow 4114.8/63371: 6% mana arcane_charge(2)
3:53.256 aoe q arcane_explosion Fluffy_Pillow 57959.4/63371: 91% mana arcane_charge(2)
3:54.562 aoe q arcane_explosion Fluffy_Pillow 54614.7/63371: 86% mana arcane_charge(3), clearcasting
3:55.867 aoe r arcane_barrage Fluffy_Pillow 56268.7/63371: 89% mana arcane_charge(4)
3:57.175 aoe p arcane_orb Fluffy_Pillow 60461.4/63371: 95% mana
3:58.481 aoe r arcane_barrage Fluffy_Pillow 61616.6/63371: 97% mana arcane_charge(4)
3:59.787 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
4:01.094 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, clearcasting
4:02.400 aoe q arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2)
4:03.708 aoe q arcane_explosion Fluffy_Pillow 58341.0/63371: 92% mana arcane_charge(3), clearcasting
4:05.015 aoe r arcane_barrage Fluffy_Pillow 59997.5/63371: 95% mana arcane_charge(4)
4:06.322 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
4:07.629 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge
4:08.936 aoe q arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2)
4:10.241 shared_cds y use_mana_gem Necrolord_Marileth 53338.5/63371: 84% mana arcane_charge(3)
4:10.241 aoe q arcane_explosion Fluffy_Pillow 59675.6/63371: 94% mana arcane_charge(3)
4:11.548 aoe r arcane_barrage Fluffy_Pillow 56332.2/63371: 89% mana arcane_charge(4)
4:12.854 aoe k touch_of_the_magi Fluffy_Pillow 60522.3/63371: 96% mana
4:14.317 aoe j deathborne Fluffy_Pillow 59876.5/63371: 94% mana arcane_charge(4)
4:15.623 aoe l arcane_power Fluffy_Pillow 59031.8/63371: 93% mana arcane_charge(4), deathborne
4:15.623 shared_cds { berserking Fluffy_Pillow 59031.8/63371: 93% mana arcane_charge(4), arcane_power, rune_of_power, deathborne
4:15.623 aoe o arcane_blast Fluffy_Pillow 59031.8/63371: 93% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:16.835 aoe o arcane_blast Fluffy_Pillow 57130.4/63371: 90% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:18.046 aoe o arcane_blast Fluffy_Pillow 55227.8/63371: 87% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:19.257 aoe n presence_of_mind Fluffy_Pillow 53325.1/63371: 84% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:19.257 aoe o arcane_blast Fluffy_Pillow 53325.1/63371: 84% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne
4:20.445 aoe o arcane_blast Fluffy_Pillow 51393.3/63371: 81% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(2), rune_of_power, deathborne
4:21.633 aoe o arcane_blast Fluffy_Pillow 49461.5/63371: 78% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind, rune_of_power, deathborne
4:22.824 aoe o arcane_blast Fluffy_Pillow 47533.5/63371: 75% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:24.036 aoe o arcane_blast Fluffy_Pillow 45632.2/63371: 72% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:25.247 aoe o arcane_blast Fluffy_Pillow 43729.5/63371: 69% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:26.460 aoe o arcane_blast Fluffy_Pillow 41829.4/63371: 66% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:27.673 aoe m rune_of_power Fluffy_Pillow 39929.3/63371: 63% mana arcane_charge(4), arcane_power, clearcasting, deathborne
4:28.979 aoe o arcane_blast Fluffy_Pillow 41584.6/63371: 66% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:30.313 aoe o arcane_blast Fluffy_Pillow 39837.8/63371: 63% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:31.645 aoe o arcane_blast Fluffy_Pillow 34651.0/63371: 55% mana arcane_charge(4), clearcasting(2), rune_of_power, deathborne
4:32.978 aoe o arcane_blast Fluffy_Pillow 29465.5/63371: 46% mana arcane_charge(4), clearcasting(2), rune_of_power, deathborne
4:34.309 aoe o arcane_blast Fluffy_Pillow 24277.5/63371: 38% mana arcane_charge(4), clearcasting(2), rune_of_power, deathborne
4:35.641 aoe r arcane_barrage Fluffy_Pillow 19090.7/63371: 30% mana arcane_charge(4), clearcasting(2), rune_of_power
4:36.948 aoe p arcane_orb Fluffy_Pillow 23282.1/63371: 37% mana clearcasting(2), rune_of_power
4:38.256 aoe r arcane_barrage Fluffy_Pillow 24439.8/63371: 39% mana arcane_charge(4), clearcasting(2), rune_of_power
4:39.561 aoe q arcane_explosion Fluffy_Pillow 28628.7/63371: 45% mana clearcasting(2), rune_of_power
4:40.869 aoe q arcane_explosion Fluffy_Pillow 30286.5/63371: 48% mana arcane_charge, clearcasting, rune_of_power
4:42.174 aoe q arcane_explosion Fluffy_Pillow 31940.5/63371: 50% mana arcane_charge(2)
4:43.481 aoe q arcane_explosion Fluffy_Pillow 28597.0/63371: 45% mana arcane_charge(3)
4:44.788 aoe r arcane_barrage Fluffy_Pillow 25253.6/63371: 40% mana arcane_charge(4), clearcasting
4:46.094 aoe q arcane_explosion Fluffy_Pillow 29443.7/63371: 46% mana clearcasting
4:47.400 aoe q arcane_explosion Fluffy_Pillow 31098.9/63371: 49% mana arcane_charge
4:48.708 aoe q arcane_explosion Fluffy_Pillow 27756.7/63371: 44% mana arcane_charge(2)
4:50.015 aoe q arcane_explosion Fluffy_Pillow 24413.3/63371: 39% mana arcane_charge(3)
4:51.321 aoe r arcane_barrage Fluffy_Pillow 21068.5/63371: 33% mana arcane_charge(4)
4:52.627 aoe q arcane_explosion Fluffy_Pillow 25258.6/63371: 40% mana
4:53.934 aoe q arcane_explosion Fluffy_Pillow 21915.2/63371: 35% mana arcane_charge
4:55.241 aoe q arcane_explosion Fluffy_Pillow 18571.7/63371: 29% mana arcane_charge(2)
4:56.549 aoe q arcane_explosion Fluffy_Pillow 15229.5/63371: 24% mana arcane_charge(3), clearcasting
4:57.855 aoe r arcane_barrage Fluffy_Pillow 16884.8/63371: 27% mana arcane_charge(4)
4:59.160 aoe p arcane_orb Fluffy_Pillow 21073.6/63371: 33% mana
5:00.466 aoe r arcane_barrage Fluffy_Pillow 22228.9/63371: 35% mana arcane_charge(4)
5:01.774 aoe q arcane_explosion Fluffy_Pillow 26421.5/63371: 42% mana
5:03.079 aoe q arcane_explosion Fluffy_Pillow 23075.5/63371: 36% mana arcane_charge, clearcasting
5:04.386 aoe q arcane_explosion Fluffy_Pillow 24732.0/63371: 39% mana arcane_charge(2)
5:05.693 aoe q arcane_explosion Fluffy_Pillow 21388.6/63371: 34% mana arcane_charge(3)
5:07.001 aoe r arcane_barrage Fluffy_Pillow 18046.4/63371: 28% mana arcane_charge(4)
5:08.308 aoe q arcane_explosion Fluffy_Pillow 22237.8/63371: 35% mana
5:09.614 aoe q arcane_explosion Fluffy_Pillow 18893.0/63371: 30% mana arcane_charge, clearcasting
5:10.920 aoe q arcane_explosion Fluffy_Pillow 20548.3/63371: 32% mana arcane_charge(2)
5:12.227 aoe q arcane_explosion Fluffy_Pillow 17204.8/63371: 27% mana arcane_charge(3)
5:13.534 aoe r arcane_barrage Fluffy_Pillow 13861.3/63371: 22% mana arcane_charge(4)
5:14.841 aoe k touch_of_the_magi Fluffy_Pillow 18052.7/63371: 28% mana
5:16.148 aoe m rune_of_power Fluffy_Pillow 17209.3/63371: 27% mana arcane_charge(4), clearcasting
5:17.454 aoe r arcane_barrage Fluffy_Pillow 18864.5/63371: 30% mana arcane_charge(4), clearcasting, rune_of_power
5:18.759 aoe q arcane_explosion Fluffy_Pillow 23053.4/63371: 36% mana clearcasting, rune_of_power
5:20.066 aoe q arcane_explosion Fluffy_Pillow 24709.9/63371: 39% mana arcane_charge, rune_of_power
5:21.374 aoe q arcane_explosion Fluffy_Pillow 21367.7/63371: 34% mana arcane_charge(2), rune_of_power
5:22.680 aoe q arcane_explosion Fluffy_Pillow 18023.0/63371: 28% mana arcane_charge(3), rune_of_power
5:23.986 aoe r arcane_barrage Fluffy_Pillow 14678.2/63371: 23% mana arcane_charge(4), rune_of_power
5:25.291 aoe p arcane_orb Fluffy_Pillow 18867.1/63371: 30% mana rune_of_power
5:26.597 aoe r arcane_barrage Fluffy_Pillow 20022.3/63371: 32% mana arcane_charge(4), rune_of_power
5:27.903 aoe q arcane_explosion Fluffy_Pillow 24212.4/63371: 38% mana rune_of_power
5:29.211 aoe q arcane_explosion Fluffy_Pillow 20870.2/63371: 33% mana arcane_charge, rune_of_power
5:30.517 aoe q arcane_explosion Fluffy_Pillow 17525.5/63371: 28% mana arcane_charge(2)
5:31.823 aoe q arcane_explosion Fluffy_Pillow 14180.8/63371: 22% mana arcane_charge(3)
5:33.130 aoe r arcane_barrage Fluffy_Pillow 10837.3/63371: 17% mana arcane_charge(4), clearcasting
5:34.435 aoe q arcane_explosion Fluffy_Pillow 15026.1/63371: 24% mana clearcasting
5:35.741 aoe q arcane_explosion Fluffy_Pillow 16681.4/63371: 26% mana arcane_charge
5:37.047 aoe q arcane_explosion Fluffy_Pillow 13336.7/63371: 21% mana arcane_charge(2)
5:38.353 aoe q arcane_explosion Fluffy_Pillow 9991.9/63371: 16% mana arcane_charge(3)
5:39.658 aoe r arcane_barrage Fluffy_Pillow 6645.9/63371: 10% mana arcane_charge(4)
5:40.966 aoe q arcane_explosion Fluffy_Pillow 10838.6/63371: 17% mana
5:42.273 aoe q arcane_explosion Fluffy_Pillow 7495.1/63371: 12% mana arcane_charge
5:43.580 aoe s evocation Fluffy_Pillow 4151.6/63371: 7% mana arcane_charge(2)
5:47.925 aoe q arcane_explosion Fluffy_Pillow 57997.6/63371: 92% mana arcane_charge(2)
5:49.230 aoe q arcane_explosion Fluffy_Pillow 54651.6/63371: 86% mana arcane_charge(3)
5:50.538 aoe r arcane_barrage Fluffy_Pillow 51309.4/63371: 81% mana arcane_charge(4)
5:51.844 aoe p arcane_orb Fluffy_Pillow 55499.5/63371: 88% mana
5:53.151 aoe r arcane_barrage Fluffy_Pillow 56656.0/63371: 89% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Marileth"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream : 10898 dps, 4604 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10898.5 10898.5 13.9 / 0.127% 962.6 / 8.8% 5.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
1887.5 1781.3 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 10898
Arcane Barrage 3900 35.8% 54.4 5.53sec 21512 17376 Direct 162.8 6021 12026 7183 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.36 162.83 0.00 0.00 1.2380 0.0000 1169319.42 1169319.42 0.00% 17376.28 17376.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 131.32 91 168 6021.25 2082 25140 6020.54 5312 6622 790391 790391 0.00%
crit 19.35% 31.51 15 53 12025.62 4164 50280 12035.29 7678 17121 378928 378928 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.36
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 285 2.6% 41.3 6.95sec 2072 0 Direct 123.8 579 1155 691 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.27 123.80 0.00 0.00 0.0000 0.0000 85489.03 85489.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 99.74 65 133 578.56 443 664 578.54 558 601 57702 57702 0.00%
crit 19.43% 24.06 11 39 1155.20 886 1329 1154.89 988 1277 27787 27787 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4472 41.0% 142.4 2.08sec 9414 7565 Direct 427.3 2629 5262 3138 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.44 427.33 0.00 0.00 1.2443 0.0000 1340914.82 1340914.82 0.00% 7565.45 7565.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 344.81 262 429 2629.47 1958 4112 2629.91 2535 2712 906739 906739 0.00%
crit 19.31% 82.51 47 123 5261.81 3916 8223 5261.90 4834 5803 434176 434176 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.44
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (869) 0.0% (8.0%) 13.4 22.93sec 19407 15855

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.43 0.00 0.00 0.00 1.2241 0.0000 0.00 0.00 0.00% 15854.63 15854.63

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.42
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 869 8.0% 40.2 22.93sec 6481 0 Direct 40.2 5415 10892 6480 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.20 40.20 0.00 0.00 0.0000 0.0000 260554.93 260554.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 32.39 20 44 5415.01 3869 8126 5414.53 4837 5894 175396 175396 0.00%
crit 19.44% 7.82 1 18 10891.85 7739 16251 10901.40 7739 16251 85159 85159 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (0.8%) 18.7 9.50sec 1384 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 0.8% 18.7 9.50sec 1384 0 Direct 18.7 1164 2327 1384 18.9%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.74 18.74 0.00 0.00 0.0000 0.0000 25932.31 25932.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.08% 15.20 3 28 1163.53 1164 1164 1163.53 1164 1164 17681 17681 0.00%
crit 18.92% 3.55 0 13 2327.06 2327 2327 2233.37 0 2327 8251 8251 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1750 18.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1749.56 1749.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.84% 0.82 0 1 1480.68 1481 1481 1211.79 0 1481 1212 1212 0.00%
crit 18.16% 0.18 0 1 2961.35 2961 2961 537.76 0 2961 538 538 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5791 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.2% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5790.90 5790.90 0.00% 49.17 49.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 72.62 59 83 53.93 43 60 53.93 52 56 3917 3917 0.00%
crit 19.31% 17.38 7 31 107.85 86 120 107.86 95 118 1874 1874 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 395 3.6% 6.1 48.45sec 19559 5477 Periodic 72.2 1372 2745 1640 19.5% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 24.08 72.23 3.5707 0.8348 118411.88 118411.88 0.00% 5477.47 5477.47
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.55% 58.18 40 76 1372.31 1372 1372 1372.31 1372 1372 79843 79843 0.00%
crit 19.45% 14.05 4 29 2744.61 2745 2745 2744.61 2745 2745 38569 38569 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.05
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (866) 0.0% (7.9%) 6.6 48.82sec 39065 29904

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.64 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 29903.75 29903.75

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.68
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 866 7.9% 6.6 48.69sec 39065 0 Direct 19.8 13101 0 13101 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.64 19.80 0.00 0.00 0.0000 0.0000 259235.63 259235.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.80 15 24 13101.17 3377 50396 13123.44 10549 16694 259236 259236 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11412.45
  • base_dd_max:11412.45
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream
Arcane Power 3.6 97.20sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.75sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.2 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.24 0.00 1.42 0.00 4.2059 0.7194 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.24
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.45sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.48
  • if_expr:buff.arcane_power.up
Rune of Power 6.5 47.12sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.49 0.00 0.00 0.00 1.2602 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.51
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.73sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.79
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.1 147.6 5.5sec 1.5sec 4.1sec 75.62% 0.00% 2.1 (3.2) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.8s
  • trigger_min/max:0.0s / 9.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:18.15%
  • arcane_charge_2:15.59%
  • arcane_charge_3:14.60%
  • arcane_charge_4:27.27%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.11% 23.65% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.7s / 199.4s
  • trigger_min/max:192.7s / 199.4s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.2 12.9sec 12.8sec 2.2sec 16.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.56%
  • clearcasting_2:0.34%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.2 0.0 0.0sec 0.0sec 4.2sec 0.34% 0.00% 0.9 (0.9) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:0.35%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.4sec 11.34% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.34%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.1sec 31.1sec 11.8sec 39.36% 0.00% 0.0 (0.0) 9.6

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.8s
  • trigger_min/max:14.4s / 48.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.36%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.68% 0.76% 6.28% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.091144.122263.871
Evocation234.58193.143340.764287.122162.137359.871
Rune of Power13.4700.00731.49090.54072.159109.125
Touch of the Magi12.2310.00021.64084.06868.084106.470
Arcane Power1.2200.0046.1264.3421.9679.124
Arcane Barrage3.0310.00212.170166.124132.637200.397
Arcane Orb4.2560.00011.68757.86535.95876.218
Shifting Power7.8580.00030.23247.83942.72257.071

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
mana_regen Mana 691.84 372379.24 69.66% 538.25 7429.85 1.96%
Evocation Mana 11.29 11351.55 2.12% 1005.49 0.00 0.00%
Mana Gem Mana 2.79 17675.13 3.31% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.36 133125.33 24.91% 2448.77 4680.03 3.40%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1781.34 1887.53 12105.7 31503.3 16.9 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream
arcane_explosion Mana 142.4 527816.3 3705.4 3705.5 2.5
arcane_orb Mana 13.4 5840.2 435.1 435.0 44.6
shifting_power Mana 6.1 15133.8 2500.0 2499.7 7.8
touch_of_the_magi Mana 6.6 16601.8 2500.0 2501.8 15.6

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
NightFae_Dream Damage Per Second
Count 1217
Mean 10898.49
Minimum 10290.25
Maximum 11752.00
Spread ( max - min ) 1461.75
Range [ ( max - min ) / 2 * 100% ] 6.71%
Standard Deviation 246.9989
5th Percentile 10503.42
95th Percentile 11318.56
( 95th Percentile - 5th Percentile ) 815.14
Mean Distribution
Standard Deviation 7.0803
95.00% Confidence Interval ( 10884.62 - 10912.37 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1974
0.1 Scale Factor Error with Delta=300 521
0.05 Scale Factor Error with Delta=300 2084
0.01 Scale Factor Error with Delta=300 52081
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 1217
Mean 4604.33
Minimum 4126.26
Maximum 5203.84
Spread ( max - min ) 1077.58
Range [ ( max - min ) / 2 * 100% ] 11.70%
Standard Deviation 155.7272
5th Percentile 4360.46
95th Percentile 4865.07
( 95th Percentile - 5th Percentile ) 504.61
Mean Distribution
Standard Deviation 4.4639
95.00% Confidence Interval ( 4595.58 - 4613.08 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4395
0.1 Scale Factor Error with Delta=300 208
0.05 Scale Factor Error with Delta=300 829
0.01 Scale Factor Error with Delta=300 20703
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 1217
Mean 10898.49
Minimum 10290.25
Maximum 11752.00
Spread ( max - min ) 1461.75
Range [ ( max - min ) / 2 * 100% ] 6.71%
Damage
NightFae_Dream Damage
Count 1217
Mean 3261607.58
Minimum 2577176.22
Maximum 3988030.86
Spread ( max - min ) 1410854.63
Range [ ( max - min ) / 2 * 100% ] 21.63%
DTPS
NightFae_Dream Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.68 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.51 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.42 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.05 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.44 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.36 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.24 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.79 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.48 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpooooporooopjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpooooproooonpmpoooopoooopjkpoooopmspoooolpoooopoooonpmpoooopoooopjlpoooopm

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.305 aoe k arcane_power Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), clearcasting
0:01.305 shared_cds s potion Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power
0:01.305 shared_cds t berserking Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:01.305 aoe p arcane_barrage Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:02.219 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:03.131 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.045 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.959 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.875 aoe o arcane_explosion Fluffy_Pillow 62032.4/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.790 aoe o arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.705 aoe p arcane_barrage Fluffy_Pillow 59351.8/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.620 aoe o arcane_explosion Fluffy_Pillow 63046.3/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.534 aoe o arcane_explosion Fluffy_Pillow 61704.8/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.449 aoe o arcane_explosion Fluffy_Pillow 60364.5/63371: 95% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.363 aoe o arcane_explosion Fluffy_Pillow 59022.9/63371: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.277 aoe p arcane_barrage Fluffy_Pillow 57681.3/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.190 aoe o arcane_explosion Fluffy_Pillow 61373.3/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.103 aoe o arcane_explosion Fluffy_Pillow 60030.5/63371: 95% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:15.109 aoe o arcane_explosion Fluffy_Pillow 58805.5/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.115 aoe o arcane_explosion Fluffy_Pillow 57580.6/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.122 aoe l rune_of_power Fluffy_Pillow 56356.9/63371: 89% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.128 aoe p arcane_barrage Fluffy_Pillow 57631.9/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.135 aoe o arcane_explosion Fluffy_Pillow 61443.1/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.141 aoe o arcane_explosion Fluffy_Pillow 57718.1/63371: 91% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.147 aoe o arcane_explosion Fluffy_Pillow 53993.1/63371: 85% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, potion_of_deathly_fixation
0:22.155 aoe o arcane_explosion Fluffy_Pillow 55270.7/63371: 87% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.160 shared_cds r use_mana_gem NightFae_Dream 51544.5/63371: 81% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:23.160 aoe p arcane_barrage Fluffy_Pillow 57881.6/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.167 aoe m arcane_orb Fluffy_Pillow 61692.8/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.174 aoe p arcane_barrage Fluffy_Pillow 62469.1/63371: 99% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.179 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.187 aoe o arcane_explosion Fluffy_Pillow 59649.0/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.193 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:29.199 aoe o arcane_explosion Fluffy_Pillow 52199.1/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:30.205 aoe n shifting_power Fluffy_Pillow 48474.1/63371: 76% mana bloodlust, arcane_charge(4)
0:33.215 aoe p arcane_barrage Fluffy_Pillow 49789.1/63371: 79% mana bloodlust, arcane_charge(4)
0:34.222 aoe m arcane_orb Fluffy_Pillow 53600.2/63371: 85% mana bloodlust
0:35.229 aoe p arcane_barrage Fluffy_Pillow 54376.5/63371: 86% mana bloodlust, arcane_charge(4)
0:36.236 aoe o arcane_explosion Fluffy_Pillow 58187.7/63371: 92% mana bloodlust
0:37.243 aoe o arcane_explosion Fluffy_Pillow 54464.0/63371: 86% mana bloodlust, arcane_charge
0:38.248 aoe o arcane_explosion Fluffy_Pillow 50737.7/63371: 80% mana bloodlust, arcane_charge(2)
0:39.253 aoe o arcane_explosion Fluffy_Pillow 47011.5/63371: 74% mana bloodlust, arcane_charge(3)
0:40.257 aoe p arcane_barrage Fluffy_Pillow 43284.0/63371: 68% mana bloodlust, arcane_charge(4), clearcasting
0:41.264 aoe o arcane_explosion Fluffy_Pillow 47095.2/63371: 74% mana clearcasting
0:42.571 aoe o arcane_explosion Fluffy_Pillow 48751.7/63371: 77% mana arcane_charge
0:43.878 aoe o arcane_explosion Fluffy_Pillow 45408.2/63371: 72% mana arcane_charge(2), clearcasting
0:45.183 aoe o arcane_explosion Fluffy_Pillow 47062.2/63371: 74% mana arcane_charge(3)
0:46.490 aoe p arcane_barrage Fluffy_Pillow 43718.7/63371: 69% mana arcane_charge(4)
0:47.795 aoe o arcane_explosion Fluffy_Pillow 47907.6/63371: 76% mana
0:49.101 aoe o arcane_explosion Fluffy_Pillow 44562.9/63371: 70% mana arcane_charge
0:50.408 aoe j touch_of_the_magi Fluffy_Pillow 41219.4/63371: 65% mana arcane_charge(2)
0:51.714 aoe l rune_of_power Fluffy_Pillow 40374.6/63371: 64% mana arcane_charge(4)
0:53.019 aoe p arcane_barrage Fluffy_Pillow 42028.6/63371: 66% mana arcane_charge(4), rune_of_power
0:54.325 aoe m arcane_orb Fluffy_Pillow 46218.8/63371: 73% mana rune_of_power
0:55.631 aoe p arcane_barrage Fluffy_Pillow 47374.0/63371: 75% mana arcane_charge(4), rune_of_power
0:56.938 aoe o arcane_explosion Fluffy_Pillow 51565.4/63371: 81% mana rune_of_power
0:58.244 aoe o arcane_explosion Fluffy_Pillow 48220.7/63371: 76% mana arcane_charge, rune_of_power
0:59.550 aoe o arcane_explosion Fluffy_Pillow 44875.9/63371: 71% mana arcane_charge(2), rune_of_power
1:00.857 aoe o arcane_explosion Fluffy_Pillow 41532.5/63371: 66% mana arcane_charge(3), clearcasting, rune_of_power
1:02.165 aoe p arcane_barrage Fluffy_Pillow 43190.3/63371: 68% mana arcane_charge(4), rune_of_power
1:03.473 aoe o arcane_explosion Fluffy_Pillow 47382.9/63371: 75% mana rune_of_power
1:04.779 aoe o arcane_explosion Fluffy_Pillow 44038.2/63371: 69% mana arcane_charge, rune_of_power
1:06.086 aoe o arcane_explosion Fluffy_Pillow 40694.7/63371: 64% mana arcane_charge(2)
1:07.392 aoe o arcane_explosion Fluffy_Pillow 37350.0/63371: 59% mana arcane_charge(3)
1:08.696 aoe p arcane_barrage Fluffy_Pillow 34002.7/63371: 54% mana arcane_charge(4)
1:10.004 aoe o arcane_explosion Fluffy_Pillow 38195.3/63371: 60% mana
1:11.310 aoe o arcane_explosion Fluffy_Pillow 34850.6/63371: 55% mana arcane_charge
1:12.616 aoe o arcane_explosion Fluffy_Pillow 31505.9/63371: 50% mana arcane_charge(2)
1:13.924 aoe o arcane_explosion Fluffy_Pillow 28163.7/63371: 44% mana arcane_charge(3)
1:15.231 aoe n shifting_power Fluffy_Pillow 24820.2/63371: 39% mana arcane_charge(4), clearcasting
1:18.984 aoe p arcane_barrage Fluffy_Pillow 27076.9/63371: 43% mana arcane_charge(4), clearcasting
1:20.289 aoe m arcane_orb Fluffy_Pillow 31265.7/63371: 49% mana clearcasting
1:21.595 aoe p arcane_barrage Fluffy_Pillow 32421.0/63371: 51% mana arcane_charge(4), clearcasting
1:22.902 aoe o arcane_explosion Fluffy_Pillow 36612.4/63371: 58% mana clearcasting
1:24.208 aoe o arcane_explosion Fluffy_Pillow 38267.6/63371: 60% mana arcane_charge
1:25.515 aoe o arcane_explosion Fluffy_Pillow 34924.1/63371: 55% mana arcane_charge(2)
1:26.821 aoe o arcane_explosion Fluffy_Pillow 31579.4/63371: 50% mana arcane_charge(3)
1:28.127 aoe p arcane_barrage Fluffy_Pillow 28234.7/63371: 45% mana arcane_charge(4), clearcasting
1:29.433 aoe o arcane_explosion Fluffy_Pillow 32424.8/63371: 51% mana clearcasting
1:30.739 aoe o arcane_explosion Fluffy_Pillow 34080.0/63371: 54% mana arcane_charge
1:32.045 aoe o arcane_explosion Fluffy_Pillow 30735.3/63371: 49% mana arcane_charge(2)
1:33.350 aoe o arcane_explosion Fluffy_Pillow 27389.3/63371: 43% mana arcane_charge(3), clearcasting
1:34.656 aoe p arcane_barrage Fluffy_Pillow 29044.6/63371: 46% mana arcane_charge(4)
1:35.964 aoe o arcane_explosion Fluffy_Pillow 33237.2/63371: 52% mana
1:37.269 aoe j touch_of_the_magi Fluffy_Pillow 29891.2/63371: 47% mana arcane_charge
1:38.575 aoe k arcane_power Fluffy_Pillow 29046.5/63371: 46% mana arcane_charge(4)
1:38.575 aoe p arcane_barrage Fluffy_Pillow 29046.5/63371: 46% mana arcane_charge(4), arcane_power, rune_of_power
1:39.880 aoe o arcane_explosion Fluffy_Pillow 33235.3/63371: 52% mana arcane_power, rune_of_power
1:41.186 aoe o arcane_explosion Fluffy_Pillow 32390.6/63371: 51% mana arcane_charge, arcane_power, rune_of_power
1:42.494 aoe o arcane_explosion Fluffy_Pillow 31548.4/63371: 50% mana arcane_charge(2), arcane_power, rune_of_power
1:43.802 aoe o arcane_explosion Fluffy_Pillow 30706.2/63371: 48% mana arcane_charge(3), arcane_power, rune_of_power
1:45.108 aoe p arcane_barrage Fluffy_Pillow 29861.4/63371: 47% mana arcane_charge(4), arcane_power, rune_of_power
1:46.412 aoe m arcane_orb Fluffy_Pillow 34049.0/63371: 54% mana arcane_power, rune_of_power
1:47.718 aoe p arcane_barrage Fluffy_Pillow 35454.3/63371: 56% mana arcane_charge(4), arcane_power, rune_of_power
1:49.024 aoe o arcane_explosion Fluffy_Pillow 39644.4/63371: 63% mana arcane_power, rune_of_power
1:50.330 aoe o arcane_explosion Fluffy_Pillow 38799.7/63371: 61% mana arcane_charge, arcane_power, rune_of_power
1:51.637 aoe o arcane_explosion Fluffy_Pillow 37956.2/63371: 60% mana arcane_charge(2), arcane_power
1:52.942 aoe o arcane_explosion Fluffy_Pillow 37110.2/63371: 59% mana arcane_charge(3), arcane_power
1:54.249 aoe l rune_of_power Fluffy_Pillow 36266.7/63371: 57% mana arcane_charge(4)
1:55.556 aoe p arcane_barrage Fluffy_Pillow 37923.2/63371: 60% mana arcane_charge(4), rune_of_power
1:56.864 aoe o arcane_explosion Fluffy_Pillow 42115.9/63371: 66% mana rune_of_power
1:58.171 aoe o arcane_explosion Fluffy_Pillow 38772.4/63371: 61% mana arcane_charge, rune_of_power
1:59.477 aoe o arcane_explosion Fluffy_Pillow 35427.7/63371: 56% mana arcane_charge(2), rune_of_power
2:00.783 aoe o arcane_explosion Fluffy_Pillow 32083.0/63371: 51% mana arcane_charge(3), rune_of_power
2:02.089 aoe p arcane_barrage Fluffy_Pillow 28738.2/63371: 45% mana arcane_charge(4), rune_of_power
2:03.396 aoe o arcane_explosion Fluffy_Pillow 32929.6/63371: 52% mana rune_of_power
2:04.704 aoe o arcane_explosion Fluffy_Pillow 29587.4/63371: 47% mana arcane_charge, rune_of_power
2:06.010 aoe o arcane_explosion Fluffy_Pillow 26242.7/63371: 41% mana arcane_charge(2), rune_of_power
2:07.316 aoe o arcane_explosion Fluffy_Pillow 22897.9/63371: 36% mana arcane_charge(3), rune_of_power
2:08.623 aoe n shifting_power Fluffy_Pillow 19554.5/63371: 31% mana arcane_charge(4)
2:12.249 aoe p arcane_barrage Fluffy_Pillow 21650.1/63371: 34% mana arcane_charge(4), clearcasting
2:13.555 aoe m arcane_orb Fluffy_Pillow 25840.3/63371: 41% mana clearcasting
2:14.863 aoe p arcane_barrage Fluffy_Pillow 26998.1/63371: 43% mana arcane_charge(4), clearcasting
2:16.170 aoe o arcane_explosion Fluffy_Pillow 31189.5/63371: 49% mana clearcasting
2:17.476 aoe o arcane_explosion Fluffy_Pillow 32844.7/63371: 52% mana arcane_charge
2:18.782 aoe o arcane_explosion Fluffy_Pillow 29500.0/63371: 47% mana arcane_charge(2), clearcasting
2:20.089 aoe o arcane_explosion Fluffy_Pillow 31156.5/63371: 49% mana arcane_charge(3)
2:21.397 aoe p arcane_barrage Fluffy_Pillow 27814.3/63371: 44% mana arcane_charge(4), clearcasting
2:22.702 aoe o arcane_explosion Fluffy_Pillow 32003.2/63371: 51% mana clearcasting
2:24.009 shared_cds r use_mana_gem NightFae_Dream 33659.7/63371: 53% mana arcane_charge
2:24.009 aoe o arcane_explosion Fluffy_Pillow 39996.8/63371: 63% mana arcane_charge
2:25.315 aoe o arcane_explosion Fluffy_Pillow 36652.1/63371: 58% mana arcane_charge(2)
2:26.622 aoe o arcane_explosion Fluffy_Pillow 33308.6/63371: 53% mana arcane_charge(3), clearcasting
2:27.930 aoe p arcane_barrage Fluffy_Pillow 34966.4/63371: 55% mana arcane_charge(4)
2:29.236 aoe j touch_of_the_magi Fluffy_Pillow 39156.5/63371: 62% mana
2:30.542 aoe l rune_of_power Fluffy_Pillow 38311.8/63371: 60% mana arcane_charge(4)
2:31.847 aoe p arcane_barrage Fluffy_Pillow 39965.8/63371: 63% mana arcane_charge(4), rune_of_power
2:33.153 aoe o arcane_explosion Fluffy_Pillow 44155.9/63371: 70% mana rune_of_power
2:34.460 aoe o arcane_explosion Fluffy_Pillow 40812.4/63371: 64% mana arcane_charge, clearcasting, rune_of_power
2:35.766 aoe o arcane_explosion Fluffy_Pillow 42467.7/63371: 67% mana arcane_charge(2), rune_of_power
2:37.072 aoe o arcane_explosion Fluffy_Pillow 39123.0/63371: 62% mana arcane_charge(3), rune_of_power
2:38.379 aoe p arcane_barrage Fluffy_Pillow 35779.5/63371: 56% mana arcane_charge(4), rune_of_power
2:39.686 aoe m arcane_orb Fluffy_Pillow 39970.9/63371: 63% mana rune_of_power
2:40.991 aoe p arcane_barrage Fluffy_Pillow 41124.9/63371: 65% mana arcane_charge(4), rune_of_power
2:42.298 aoe o arcane_explosion Fluffy_Pillow 45316.3/63371: 72% mana rune_of_power
2:43.605 aoe o arcane_explosion Fluffy_Pillow 41972.8/63371: 66% mana arcane_charge, rune_of_power
2:44.911 aoe o arcane_explosion Fluffy_Pillow 38628.0/63371: 61% mana arcane_charge(2), clearcasting
2:46.219 aoe o arcane_explosion Fluffy_Pillow 40285.8/63371: 64% mana arcane_charge(3)
2:47.525 aoe p arcane_barrage Fluffy_Pillow 36941.1/63371: 58% mana arcane_charge(4)
2:48.832 aoe o arcane_explosion Fluffy_Pillow 41132.5/63371: 65% mana
2:50.140 aoe o arcane_explosion Fluffy_Pillow 37790.3/63371: 60% mana arcane_charge
2:51.448 aoe o arcane_explosion Fluffy_Pillow 34448.1/63371: 54% mana arcane_charge(2)
2:52.754 aoe o arcane_explosion Fluffy_Pillow 31103.3/63371: 49% mana arcane_charge(3)
2:54.062 aoe n shifting_power Fluffy_Pillow 27761.1/63371: 44% mana arcane_charge(4)
2:57.784 aoe p arcane_barrage Fluffy_Pillow 29978.5/63371: 47% mana arcane_charge(4)
2:59.090 aoe m arcane_orb Fluffy_Pillow 34168.6/63371: 54% mana
3:00.395 aoe p arcane_barrage Fluffy_Pillow 35322.6/63371: 56% mana arcane_charge(4)
3:01.701 aoe o arcane_explosion Fluffy_Pillow 39512.7/63371: 62% mana
3:03.007 aoe o arcane_explosion Fluffy_Pillow 36168.0/63371: 57% mana arcane_charge
3:04.313 aoe o arcane_explosion Fluffy_Pillow 32823.3/63371: 52% mana arcane_charge(2)
3:05.619 aoe o arcane_explosion Fluffy_Pillow 29478.5/63371: 47% mana arcane_charge(3), clearcasting
3:06.926 aoe p arcane_barrage Fluffy_Pillow 31135.1/63371: 49% mana arcane_charge(4)
3:08.231 aoe o arcane_explosion Fluffy_Pillow 35323.9/63371: 56% mana
3:09.539 aoe o arcane_explosion Fluffy_Pillow 31981.7/63371: 50% mana arcane_charge
3:10.846 aoe o arcane_explosion Fluffy_Pillow 28638.2/63371: 45% mana arcane_charge(2)
3:12.154 aoe o arcane_explosion Fluffy_Pillow 25296.0/63371: 40% mana arcane_charge(3)
3:13.460 aoe p arcane_barrage Fluffy_Pillow 21951.3/63371: 35% mana arcane_charge(4)
3:14.766 aoe j touch_of_the_magi Fluffy_Pillow 26141.4/63371: 41% mana
3:16.073 aoe k arcane_power Fluffy_Pillow 25297.9/63371: 40% mana arcane_charge(4)
3:16.073 shared_cds t berserking Fluffy_Pillow 25297.9/63371: 40% mana arcane_charge(4), arcane_power, rune_of_power
3:16.073 aoe p arcane_barrage Fluffy_Pillow 25297.9/63371: 40% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.260 aoe o arcane_explosion Fluffy_Pillow 29337.2/63371: 46% mana berserking, arcane_power, rune_of_power
3:18.449 aoe o arcane_explosion Fluffy_Pillow 28344.2/63371: 45% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power
3:19.636 aoe o arcane_explosion Fluffy_Pillow 29848.6/63371: 47% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.826 aoe o arcane_explosion Fluffy_Pillow 28856.9/63371: 46% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:22.014 aoe p arcane_barrage Fluffy_Pillow 27862.6/63371: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.203 aoe m arcane_orb Fluffy_Pillow 31904.4/63371: 50% mana berserking, arcane_power, rune_of_power
3:24.392 aoe p arcane_barrage Fluffy_Pillow 33161.4/63371: 52% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:25.580 aoe o arcane_explosion Fluffy_Pillow 37202.0/63371: 59% mana berserking, arcane_power, rune_of_power
3:26.769 aoe o arcane_explosion Fluffy_Pillow 36208.9/63371: 57% mana berserking, arcane_charge, arcane_power, rune_of_power
3:27.958 aoe o arcane_explosion Fluffy_Pillow 35215.9/63371: 56% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:29.147 aoe o arcane_explosion Fluffy_Pillow 34222.9/63371: 54% mana arcane_charge(3), arcane_power
3:30.453 aoe l rune_of_power Fluffy_Pillow 33378.1/63371: 53% mana arcane_charge(4), arcane_power
3:31.757 aoe p arcane_barrage Fluffy_Pillow 35030.9/63371: 55% mana arcane_charge(4), rune_of_power
3:33.062 aoe o arcane_explosion Fluffy_Pillow 39219.7/63371: 62% mana rune_of_power
3:34.369 aoe o arcane_explosion Fluffy_Pillow 35876.2/63371: 57% mana arcane_charge, clearcasting, rune_of_power
3:35.676 aoe o arcane_explosion Fluffy_Pillow 37532.8/63371: 59% mana arcane_charge(2), rune_of_power
3:36.984 aoe o arcane_explosion Fluffy_Pillow 34190.6/63371: 54% mana arcane_charge(3), rune_of_power
3:38.289 aoe p arcane_barrage Fluffy_Pillow 30844.6/63371: 49% mana arcane_charge(4), rune_of_power
3:39.593 aoe o arcane_explosion Fluffy_Pillow 35032.1/63371: 55% mana rune_of_power
3:40.899 aoe o arcane_explosion Fluffy_Pillow 31687.4/63371: 50% mana arcane_charge, clearcasting, rune_of_power
3:42.205 aoe o arcane_explosion Fluffy_Pillow 33342.7/63371: 53% mana arcane_charge(2), rune_of_power
3:43.513 aoe o arcane_explosion Fluffy_Pillow 30000.5/63371: 47% mana arcane_charge(3), rune_of_power
3:44.821 aoe n shifting_power Fluffy_Pillow 26658.3/63371: 42% mana arcane_charge(4)
3:48.381 aoe p arcane_barrage Fluffy_Pillow 28670.3/63371: 45% mana arcane_charge(4)
3:49.687 aoe m arcane_orb Fluffy_Pillow 32860.4/63371: 52% mana
3:50.993 aoe p arcane_barrage Fluffy_Pillow 34015.7/63371: 54% mana arcane_charge(4)
3:52.299 aoe o arcane_explosion Fluffy_Pillow 38205.8/63371: 60% mana
3:53.606 aoe o arcane_explosion Fluffy_Pillow 34862.3/63371: 55% mana arcane_charge
3:54.912 aoe o arcane_explosion Fluffy_Pillow 31517.6/63371: 50% mana arcane_charge(2), clearcasting
3:56.219 aoe o arcane_explosion Fluffy_Pillow 33174.1/63371: 52% mana arcane_charge(3)
3:57.525 aoe p arcane_barrage Fluffy_Pillow 29829.4/63371: 47% mana arcane_charge(4)
3:58.832 aoe o arcane_explosion Fluffy_Pillow 34020.8/63371: 54% mana
4:00.139 aoe o arcane_explosion Fluffy_Pillow 30677.3/63371: 48% mana arcane_charge
4:01.445 aoe o arcane_explosion Fluffy_Pillow 27332.6/63371: 43% mana arcane_charge(2)
4:02.752 aoe o arcane_explosion Fluffy_Pillow 23989.1/63371: 38% mana arcane_charge(3)
4:04.058 aoe p arcane_barrage Fluffy_Pillow 20644.4/63371: 33% mana arcane_charge(4), clearcasting
4:05.365 aoe j touch_of_the_magi Fluffy_Pillow 24835.7/63371: 39% mana clearcasting
4:06.672 aoe l rune_of_power Fluffy_Pillow 23992.3/63371: 38% mana arcane_charge(4), clearcasting
4:07.978 aoe p arcane_barrage Fluffy_Pillow 25647.5/63371: 40% mana arcane_charge(4), clearcasting, rune_of_power
4:09.282 aoe o arcane_explosion Fluffy_Pillow 29835.1/63371: 47% mana clearcasting, rune_of_power
4:10.588 aoe o arcane_explosion Fluffy_Pillow 31490.4/63371: 50% mana arcane_charge, rune_of_power
4:11.896 aoe o arcane_explosion Fluffy_Pillow 28148.2/63371: 44% mana arcane_charge(2), rune_of_power
4:13.201 aoe o arcane_explosion Fluffy_Pillow 24802.2/63371: 39% mana arcane_charge(3), rune_of_power
4:14.509 aoe p arcane_barrage Fluffy_Pillow 21460.0/63371: 34% mana arcane_charge(4), clearcasting, rune_of_power
4:15.816 aoe m arcane_orb Fluffy_Pillow 25651.4/63371: 40% mana clearcasting, rune_of_power
4:17.123 aoe p arcane_barrage Fluffy_Pillow 26807.9/63371: 42% mana arcane_charge(4), clearcasting, rune_of_power
4:18.430 aoe o arcane_explosion Fluffy_Pillow 30999.3/63371: 49% mana clearcasting, rune_of_power
4:19.736 aoe o arcane_explosion Fluffy_Pillow 32654.5/63371: 52% mana arcane_charge, rune_of_power
4:21.042 aoe o arcane_explosion Fluffy_Pillow 29309.8/63371: 46% mana arcane_charge(2)
4:22.348 aoe o arcane_explosion Fluffy_Pillow 25965.1/63371: 41% mana arcane_charge(3)
4:23.655 aoe p arcane_barrage Fluffy_Pillow 22621.6/63371: 36% mana arcane_charge(4)
4:24.960 shared_cds r use_mana_gem NightFae_Dream 26810.4/63371: 42% mana
4:24.960 aoe o arcane_explosion Fluffy_Pillow 33147.6/63371: 52% mana
4:26.268 aoe o arcane_explosion Fluffy_Pillow 29805.4/63371: 47% mana arcane_charge, clearcasting
4:27.576 aoe o arcane_explosion Fluffy_Pillow 31463.2/63371: 50% mana arcane_charge(2)
4:28.882 aoe o arcane_explosion Fluffy_Pillow 28118.4/63371: 44% mana arcane_charge(3), clearcasting
4:30.188 aoe n shifting_power Fluffy_Pillow 29773.7/63371: 47% mana arcane_charge(4)
4:33.982 aoe p arcane_barrage Fluffy_Pillow 32082.3/63371: 51% mana arcane_charge(4), clearcasting
4:35.289 aoe m arcane_orb Fluffy_Pillow 36273.7/63371: 57% mana clearcasting
4:36.597 aoe p arcane_barrage Fluffy_Pillow 37431.5/63371: 59% mana arcane_charge(4), clearcasting
4:37.902 aoe o arcane_explosion Fluffy_Pillow 41620.4/63371: 66% mana clearcasting
4:39.209 aoe o arcane_explosion Fluffy_Pillow 43276.9/63371: 68% mana arcane_charge
4:40.515 aoe o arcane_explosion Fluffy_Pillow 39932.1/63371: 63% mana arcane_charge(2)
4:41.821 aoe o arcane_explosion Fluffy_Pillow 36587.4/63371: 58% mana arcane_charge(3), clearcasting
4:43.127 aoe p arcane_barrage Fluffy_Pillow 38242.7/63371: 60% mana arcane_charge(4)
4:44.435 aoe o arcane_explosion Fluffy_Pillow 42435.3/63371: 67% mana
4:45.742 aoe o arcane_explosion Fluffy_Pillow 39091.8/63371: 62% mana arcane_charge
4:47.047 aoe o arcane_explosion Fluffy_Pillow 35745.8/63371: 56% mana arcane_charge(2)
4:48.355 aoe o arcane_explosion Fluffy_Pillow 32403.6/63371: 51% mana arcane_charge(3)
4:49.661 aoe p arcane_barrage Fluffy_Pillow 29058.9/63371: 46% mana arcane_charge(4), clearcasting
4:50.968 aoe j touch_of_the_magi Fluffy_Pillow 33250.3/63371: 52% mana clearcasting
4:52.274 aoe k arcane_power Fluffy_Pillow 32405.5/63371: 51% mana arcane_charge(4), clearcasting
4:52.274 aoe p arcane_barrage Fluffy_Pillow 32405.5/63371: 51% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:53.580 aoe o arcane_explosion Fluffy_Pillow 36595.7/63371: 58% mana arcane_power, clearcasting(2), rune_of_power
4:54.887 aoe o arcane_explosion Fluffy_Pillow 38252.2/63371: 60% mana arcane_charge, arcane_power, clearcasting, rune_of_power
4:56.194 aoe o arcane_explosion Fluffy_Pillow 39908.7/63371: 63% mana arcane_charge(2), arcane_power, rune_of_power
4:57.502 aoe o arcane_explosion Fluffy_Pillow 39066.5/63371: 62% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power
4:58.809 aoe p arcane_barrage Fluffy_Pillow 40723.1/63371: 64% mana arcane_charge(4), arcane_power, rune_of_power
5:00.115 aoe m arcane_orb Fluffy_Pillow 44913.2/63371: 71% mana arcane_power, rune_of_power
5:01.422 shared_cds s potion Fluffy_Pillow 46319.7/63371: 73% mana arcane_charge(4), arcane_power, rune_of_power
5:01.422 aoe p arcane_barrage Fluffy_Pillow 46319.7/63371: 73% mana arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
5:02.730 aoe o arcane_explosion Fluffy_Pillow 50512.4/63371: 80% mana arcane_power, rune_of_power, potion_of_deathly_fixation
5:04.036 aoe o arcane_explosion Fluffy_Pillow 49667.6/63371: 78% mana arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
5:05.342 aoe o arcane_explosion Fluffy_Pillow 48822.9/63371: 77% mana arcane_charge(2), arcane_power, potion_of_deathly_fixation
5:06.648 aoe o arcane_explosion Fluffy_Pillow 47978.1/63371: 76% mana arcane_charge(3), arcane_power, clearcasting, potion_of_deathly_fixation
5:07.956 aoe l rune_of_power Fluffy_Pillow 49635.9/63371: 78% mana arcane_charge(4), potion_of_deathly_fixation
5:09.263 aoe p arcane_barrage Fluffy_Pillow 51292.5/63371: 81% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:10.571 aoe o arcane_explosion Fluffy_Pillow 55485.1/63371: 88% mana rune_of_power, potion_of_deathly_fixation
5:11.876 aoe o arcane_explosion Fluffy_Pillow 52139.1/63371: 82% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:13.181 aoe o arcane_explosion Fluffy_Pillow 48793.1/63371: 77% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:14.488 aoe o arcane_explosion Fluffy_Pillow 45449.6/63371: 72% mana arcane_charge(3), rune_of_power, potion_of_deathly_fixation
5:15.794 aoe p arcane_barrage Fluffy_Pillow 42104.9/63371: 66% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.101 aoe o arcane_explosion Fluffy_Pillow 46296.3/63371: 73% mana rune_of_power, potion_of_deathly_fixation
5:18.408 aoe o arcane_explosion Fluffy_Pillow 42952.8/63371: 68% mana arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
5:19.716 aoe o arcane_explosion Fluffy_Pillow 44610.6/63371: 70% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:21.023 aoe o arcane_explosion Fluffy_Pillow 41267.1/63371: 65% mana arcane_charge(3), rune_of_power, potion_of_deathly_fixation
5:22.330 aoe n shifting_power Fluffy_Pillow 37923.7/63371: 60% mana arcane_charge(4), potion_of_deathly_fixation
5:26.074 aoe p arcane_barrage Fluffy_Pillow 40168.9/63371: 63% mana arcane_charge(4), potion_of_deathly_fixation
5:27.380 aoe m arcane_orb Fluffy_Pillow 44359.0/63371: 70% mana
5:28.687 aoe p arcane_barrage Fluffy_Pillow 45515.6/63371: 72% mana arcane_charge(4)
5:29.994 aoe o arcane_explosion Fluffy_Pillow 49707.0/63371: 78% mana
5:31.302 aoe o arcane_explosion Fluffy_Pillow 46364.8/63371: 73% mana arcane_charge, clearcasting
5:32.608 aoe o arcane_explosion Fluffy_Pillow 48020.0/63371: 76% mana arcane_charge(2)
5:33.915 aoe o arcane_explosion Fluffy_Pillow 44676.5/63371: 70% mana arcane_charge(3), clearcasting
5:35.221 aoe p arcane_barrage Fluffy_Pillow 46331.8/63371: 73% mana arcane_charge(4)
5:36.526 aoe o arcane_explosion Fluffy_Pillow 50520.7/63371: 80% mana
5:37.832 aoe o arcane_explosion Fluffy_Pillow 47175.9/63371: 74% mana arcane_charge
5:39.140 aoe o arcane_explosion Fluffy_Pillow 43833.7/63371: 69% mana arcane_charge(2)
5:40.447 aoe o arcane_explosion Fluffy_Pillow 40490.2/63371: 64% mana arcane_charge(3)
5:41.754 aoe p arcane_barrage Fluffy_Pillow 37146.8/63371: 59% mana arcane_charge(4)
5:43.059 aoe j touch_of_the_magi Fluffy_Pillow 41335.6/63371: 65% mana
5:44.364 aoe l rune_of_power Fluffy_Pillow 40489.6/63371: 64% mana arcane_charge(4)
5:45.673 aoe p arcane_barrage Fluffy_Pillow 42148.7/63371: 67% mana arcane_charge(4), rune_of_power
5:46.978 aoe o arcane_explosion Fluffy_Pillow 46337.5/63371: 73% mana rune_of_power
5:48.283 aoe o arcane_explosion Fluffy_Pillow 42991.5/63371: 68% mana arcane_charge, clearcasting, rune_of_power
5:49.590 aoe o arcane_explosion Fluffy_Pillow 44648.1/63371: 70% mana arcane_charge(2), rune_of_power
5:50.895 aoe o arcane_explosion Fluffy_Pillow 41302.1/63371: 65% mana arcane_charge(3), rune_of_power
5:52.200 aoe p arcane_barrage Fluffy_Pillow 37956.0/63371: 60% mana arcane_charge(4), rune_of_power
5:53.507 aoe m arcane_orb Fluffy_Pillow 42147.4/63371: 67% mana rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream_SB : 11049 dps, 4671 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11048.6 11048.6 14.0 / 0.127% 946.8 / 8.6% 5.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
1889.3 1783.1 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 11049
Arcane Barrage 3957 35.8% 54.3 5.54sec 21825 17629 Direct 162.8 6100 12238 7289 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.35 162.79 0.00 0.00 1.2380 0.0000 1186156.61 1186156.61 0.00% 17629.10 17629.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 131.26 97 170 6099.89 2082 25810 6100.33 5471 6781 800482 800482 0.00%
crit 19.37% 31.54 13 52 12237.81 4164 51620 12229.45 7921 17203 385675 385675 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.35
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 289 2.6% 41.3 6.94sec 2095 0 Direct 123.9 586 1171 698 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.30 123.89 0.00 0.00 0.0000 0.0000 86504.06 86504.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 100.08 69 128 585.90 443 682 585.89 563 619 58632 58632 0.00%
crit 19.22% 23.81 8 42 1170.84 886 1364 1170.44 1017 1291 27872 27872 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4527 41.0% 142.5 2.08sec 9527 7657 Direct 427.4 2664 5326 3176 19.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.46 427.38 0.00 0.00 1.2443 0.0000 1357256.33 1357256.33 0.00% 7656.69 7656.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 345.24 266 434 2664.09 1958 4221 2664.36 2562 2762 919792 919792 0.00%
crit 19.22% 82.14 49 125 5326.07 3916 8442 5326.33 4671 5875 437465 437465 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.46
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (885) 0.0% (8.0%) 13.4 22.94sec 19760 16144

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.41 0.00 0.00 0.00 1.2240 0.0000 0.00 0.00 0.00% 16143.62 16143.62

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.41
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 885 8.0% 40.2 22.93sec 6598 0 Direct 40.2 5519 11091 6598 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.17 40.17 0.00 0.00 0.0000 0.0000 265045.97 265045.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 32.41 21 45 5519.20 3869 8342 5519.28 4909 6117 178891 178891 0.00%
crit 19.33% 7.76 0 18 11090.85 7739 16685 11064.95 0 16540 86155 86155 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (0.8%) 18.6 9.55sec 1409 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.61 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 0.8% 18.6 9.55sec 1409 0 Direct 18.6 1181 2363 1410 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.61 18.61 0.00 0.00 0.0000 0.0000 26229.91 26229.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 15.02 4 29 1181.39 1164 1195 1181.40 1172 1191 17743 17743 0.00%
crit 19.30% 3.59 0 11 2362.91 2327 2389 2310.29 0 2389 8487 8487 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1520 3040 1796 17.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1791.22 1791.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.17% 0.82 0 1 1520.16 1520 1520 1249.11 0 1520 1249 1249 0.00%
crit 17.83% 0.18 0 1 3040.32 3040 3040 542.11 0 3040 542 542 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5873 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 147  / 20 0.2% 90.0 1.29sec 65 50 Direct 90.0 55 109 65 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5872.88 5872.88 0.00% 49.86 49.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 72.50 58 86 54.60 43 62 54.60 53 56 3958 3958 0.00%
crit 19.45% 17.50 4 32 109.40 86 124 109.36 94 120 1914 1914 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 399 3.6% 6.1 48.46sec 19779 5541 Periodic 72.2 1389 2779 1659 19.4% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 24.06 72.17 3.5699 0.8347 119731.52 119731.52 0.00% 5540.82 5540.82
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.60% 58.17 40 78 1389.48 1372 1409 1389.32 1382 1398 80822 80822 0.00%
crit 19.40% 14.00 5 27 2778.62 2745 2818 2778.26 2745 2818 38910 38910 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.05
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (881) 0.0% (8.0%) 6.6 48.82sec 39753 30430

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.63 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 30429.57 30429.57

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.68
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 881 8.0% 6.6 48.70sec 39753 0 Direct 19.8 13330 0 13330 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.63 19.81 0.00 0.00 0.0000 0.0000 263672.26 263672.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.81 15 24 13329.70 3377 49865 13348.64 10610 16794 263672 263672 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11378.65
  • base_dd_max:11378.65
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream_SB
Arcane Power 3.6 97.20sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.74sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.2 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.25 0.00 1.48 0.00 4.2929 0.7219 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.25
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.46sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.48
  • if_expr:buff.arcane_power.up
Rune of Power 6.5 47.10sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.49 0.00 0.00 0.00 1.2603 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.51
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.85sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.80
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.1 147.6 5.5sec 1.5sec 4.1sec 75.63% 0.00% 2.1 (3.2) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.7s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.16%
  • arcane_charge_2:15.60%
  • arcane_charge_3:14.63%
  • arcane_charge_4:27.23%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.8sec 194.8sec 12.0sec 8.11% 23.66% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.6s / 199.4s
  • trigger_min/max:192.6s / 199.4s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.4 0.2 13.0sec 12.8sec 2.3sec 16.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.65%
  • clearcasting_2:0.35%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.2 0.0 0.0sec 0.0sec 4.3sec 0.35% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:0.36%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.4sec 11.35% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.1s
  • trigger_min/max:300.0s / 301.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.35%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.1sec 31.1sec 11.8sec 39.36% 0.00% 0.0 (0.0) 9.6

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 49.8s
  • trigger_min/max:14.4s / 49.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.36%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Social Butterfly 30.5 0.0 10.0sec 10.0sec 5.0sec 50.43% 0.00% 0.0 (0.0) 30.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.43%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.68% 0.76% 5.58% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.091144.122263.871
Evocation231.33893.409350.148286.034168.236359.851
Rune of Power13.4770.01531.81190.59372.309109.257
Touch of the Magi12.2370.00021.64284.11568.087106.682
Arcane Power1.2340.0046.1284.4001.9479.178
Arcane Barrage3.0340.00112.143166.179132.664200.173
Arcane Orb4.2510.00011.61657.77737.28476.149
Shifting Power7.8710.00030.23347.92442.69857.433

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
mana_regen Mana 692.26 372386.62 69.58% 537.93 7434.95 1.96%
Evocation Mana 11.88 11951.44 2.23% 1005.88 0.00 0.00%
Mana Gem Mana 2.80 17736.80 3.31% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.35 133099.18 24.87% 2448.80 4677.40 3.39%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1783.12 1889.33 12114.1 31497.9 700.6 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
arcane_explosion Mana 142.5 528410.4 3709.3 3709.2 2.6
arcane_orb Mana 13.4 5836.2 435.2 435.1 45.4
shifting_power Mana 6.1 15131.8 2500.0 2499.7 7.9
touch_of_the_magi Mana 6.6 16593.7 2500.0 2501.8 15.9

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
NightFae_Dream_SB Damage Per Second
Count 1217
Mean 11048.56
Minimum 10370.58
Maximum 11946.01
Spread ( max - min ) 1575.42
Range [ ( max - min ) / 2 * 100% ] 7.13%
Standard Deviation 249.5228
5th Percentile 10659.94
95th Percentile 11473.27
( 95th Percentile - 5th Percentile ) 813.33
Mean Distribution
Standard Deviation 7.1526
95.00% Confidence Interval ( 11034.54 - 11062.58 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1960
0.1 Scale Factor Error with Delta=300 532
0.05 Scale Factor Error with Delta=300 2127
0.01 Scale Factor Error with Delta=300 53151
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 1217
Mean 4670.82
Minimum 4261.40
Maximum 5307.07
Spread ( max - min ) 1045.67
Range [ ( max - min ) / 2 * 100% ] 11.19%
Standard Deviation 158.7485
5th Percentile 4419.43
95th Percentile 4945.57
( 95th Percentile - 5th Percentile ) 526.14
Mean Distribution
Standard Deviation 4.5506
95.00% Confidence Interval ( 4661.90 - 4679.74 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4438
0.1 Scale Factor Error with Delta=300 216
0.05 Scale Factor Error with Delta=300 861
0.01 Scale Factor Error with Delta=300 21514
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 1217
Mean 11048.56
Minimum 10370.58
Maximum 11946.01
Spread ( max - min ) 1575.42
Range [ ( max - min ) / 2 * 100% ] 7.13%
Damage
NightFae_Dream_SB Damage
Count 1217
Mean 3306387.88
Minimum 2633665.82
Maximum 4032114.04
Spread ( max - min ) 1398448.22
Range [ ( max - min ) / 2 * 100% ] 21.15%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.68 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.51 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.41 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.05 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.46 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.35 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.25 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.80 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.48 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpooooporooopjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooqopjlpmpoooopoooorponooopmpoooopoojkpoooopmspoooolpoooopoooonpmpoooopoooopjlpoooopm

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana social_butterfly
0:01.309 aoe k arcane_power Fluffy_Pillow 60880.3/63371: 96% mana bloodlust, arcane_charge(4), social_butterfly
0:01.309 shared_cds s potion Fluffy_Pillow 60880.3/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
0:01.309 shared_cds t berserking Fluffy_Pillow 60880.3/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:01.309 aoe p arcane_barrage Fluffy_Pillow 60880.3/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:02.224 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:03.138 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.052 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.967 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:05.881 aoe o arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.795 aoe o arcane_explosion Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:07.710 aoe p arcane_barrage Fluffy_Pillow 60507.7/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.621 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.537 aoe o arcane_explosion Fluffy_Pillow 62032.4/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.450 aoe o arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:11.365 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:12.280 aoe p arcane_barrage Fluffy_Pillow 60508.9/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:13.195 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:14.108 aoe o arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, arcane_charge, arcane_power, social_butterfly, potion_of_deathly_fixation
0:15.114 aoe o arcane_explosion Fluffy_Pillow 60803.6/63371: 96% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.120 aoe o arcane_explosion Fluffy_Pillow 59578.7/63371: 94% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.126 aoe l rune_of_power Fluffy_Pillow 58353.7/63371: 92% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.132 aoe p arcane_barrage Fluffy_Pillow 59628.7/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.140 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.146 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:21.152 aoe o arcane_explosion Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:22.160 aoe o arcane_explosion Fluffy_Pillow 57199.1/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.165 shared_cds r use_mana_gem NightFae_Dream_SB 53472.8/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.165 aoe p arcane_barrage Fluffy_Pillow 59810.0/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:24.172 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:25.178 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.185 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.189 aoe o arcane_explosion Fluffy_Pillow 59643.9/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.196 aoe o arcane_explosion Fluffy_Pillow 55920.2/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:29.200 aoe o arcane_explosion Fluffy_Pillow 52192.7/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:30.207 aoe n shifting_power Fluffy_Pillow 48469.0/63371: 76% mana bloodlust, arcane_charge(4), social_butterfly
0:32.984 aoe p arcane_barrage Fluffy_Pillow 49488.7/63371: 78% mana bloodlust, arcane_charge(4), social_butterfly
0:33.991 aoe m arcane_orb Fluffy_Pillow 53299.8/63371: 84% mana bloodlust, social_butterfly
0:34.997 aoe p arcane_barrage Fluffy_Pillow 54074.9/63371: 85% mana bloodlust, arcane_charge(4), social_butterfly
0:36.003 aoe o arcane_explosion Fluffy_Pillow 57884.8/63371: 91% mana bloodlust
0:37.008 aoe o arcane_explosion Fluffy_Pillow 54158.5/63371: 85% mana bloodlust, arcane_charge
0:38.015 aoe o arcane_explosion Fluffy_Pillow 50434.8/63371: 80% mana bloodlust, arcane_charge(2)
0:39.021 aoe o arcane_explosion Fluffy_Pillow 46709.9/63371: 74% mana bloodlust, arcane_charge(3), clearcasting
0:40.028 aoe p arcane_barrage Fluffy_Pillow 47986.2/63371: 76% mana bloodlust, arcane_charge(4), social_butterfly
0:41.035 aoe o arcane_explosion Fluffy_Pillow 51797.3/63371: 82% mana social_butterfly
0:42.342 aoe o arcane_explosion Fluffy_Pillow 48453.8/63371: 76% mana arcane_charge, social_butterfly
0:43.649 aoe o arcane_explosion Fluffy_Pillow 45110.4/63371: 71% mana arcane_charge(2), social_butterfly
0:44.956 aoe o arcane_explosion Fluffy_Pillow 41766.9/63371: 66% mana arcane_charge(3), social_butterfly
0:46.262 aoe p arcane_barrage Fluffy_Pillow 38422.2/63371: 61% mana arcane_charge(4)
0:47.570 aoe o arcane_explosion Fluffy_Pillow 42614.8/63371: 67% mana
0:48.876 aoe o arcane_explosion Fluffy_Pillow 39270.1/63371: 62% mana arcane_charge
0:50.182 aoe j touch_of_the_magi Fluffy_Pillow 35925.3/63371: 57% mana arcane_charge(2), social_butterfly
0:51.489 aoe l rune_of_power Fluffy_Pillow 35081.9/63371: 55% mana arcane_charge(4), social_butterfly
0:52.796 aoe p arcane_barrage Fluffy_Pillow 36738.4/63371: 58% mana arcane_charge(4), rune_of_power, social_butterfly
0:54.103 aoe m arcane_orb Fluffy_Pillow 40929.8/63371: 65% mana rune_of_power, social_butterfly
0:55.409 aoe p arcane_barrage Fluffy_Pillow 42085.0/63371: 66% mana arcane_charge(4), rune_of_power
0:56.715 aoe o arcane_explosion Fluffy_Pillow 46275.2/63371: 73% mana rune_of_power
0:58.022 aoe o arcane_explosion Fluffy_Pillow 42931.7/63371: 68% mana arcane_charge, clearcasting, rune_of_power
0:59.329 aoe o arcane_explosion Fluffy_Pillow 44588.2/63371: 70% mana arcane_charge(2), rune_of_power
1:00.634 aoe o arcane_explosion Fluffy_Pillow 41242.2/63371: 65% mana arcane_charge(3), rune_of_power, social_butterfly
1:01.940 aoe p arcane_barrage Fluffy_Pillow 37897.5/63371: 60% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
1:03.248 aoe o arcane_explosion Fluffy_Pillow 42090.1/63371: 66% mana clearcasting, rune_of_power, social_butterfly
1:04.555 aoe o arcane_explosion Fluffy_Pillow 43746.7/63371: 69% mana arcane_charge, rune_of_power, social_butterfly
1:05.862 aoe o arcane_explosion Fluffy_Pillow 40403.2/63371: 64% mana arcane_charge(2), clearcasting
1:07.169 aoe o arcane_explosion Fluffy_Pillow 42059.7/63371: 66% mana arcane_charge(3)
1:08.475 aoe p arcane_barrage Fluffy_Pillow 38715.0/63371: 61% mana arcane_charge(4)
1:09.782 aoe o arcane_explosion Fluffy_Pillow 42906.4/63371: 68% mana
1:11.087 aoe o arcane_explosion Fluffy_Pillow 39560.4/63371: 62% mana arcane_charge, social_butterfly
1:12.394 aoe o arcane_explosion Fluffy_Pillow 36216.9/63371: 57% mana arcane_charge(2), social_butterfly
1:13.701 aoe o arcane_explosion Fluffy_Pillow 32873.4/63371: 52% mana arcane_charge(3), social_butterfly
1:15.008 aoe n shifting_power Fluffy_Pillow 29530.0/63371: 47% mana arcane_charge(4)
1:18.894 aoe p arcane_barrage Fluffy_Pillow 31955.2/63371: 50% mana arcane_charge(4)
1:20.200 aoe m arcane_orb Fluffy_Pillow 36145.3/63371: 57% mana social_butterfly
1:21.506 aoe p arcane_barrage Fluffy_Pillow 37300.6/63371: 59% mana arcane_charge(4), social_butterfly
1:22.812 aoe o arcane_explosion Fluffy_Pillow 41490.7/63371: 65% mana social_butterfly
1:24.119 aoe o arcane_explosion Fluffy_Pillow 38147.2/63371: 60% mana arcane_charge, clearcasting, social_butterfly
1:25.426 aoe o arcane_explosion Fluffy_Pillow 39803.7/63371: 63% mana arcane_charge(2)
1:26.733 aoe o arcane_explosion Fluffy_Pillow 36460.3/63371: 58% mana arcane_charge(3)
1:28.039 aoe p arcane_barrage Fluffy_Pillow 33115.5/63371: 52% mana arcane_charge(4)
1:29.348 aoe o arcane_explosion Fluffy_Pillow 37309.4/63371: 59% mana
1:30.653 aoe o arcane_explosion Fluffy_Pillow 33963.4/63371: 54% mana arcane_charge, clearcasting, social_butterfly
1:31.960 aoe o arcane_explosion Fluffy_Pillow 35620.0/63371: 56% mana arcane_charge(2), social_butterfly
1:33.267 aoe o arcane_explosion Fluffy_Pillow 32276.5/63371: 51% mana arcane_charge(3), social_butterfly
1:34.573 aoe p arcane_barrage Fluffy_Pillow 28931.8/63371: 46% mana arcane_charge(4), social_butterfly
1:35.880 aoe o arcane_explosion Fluffy_Pillow 33123.1/63371: 52% mana
1:37.186 aoe j touch_of_the_magi Fluffy_Pillow 29778.4/63371: 47% mana arcane_charge
1:38.492 aoe k arcane_power Fluffy_Pillow 28933.7/63371: 46% mana arcane_charge(4)
1:38.492 aoe p arcane_barrage Fluffy_Pillow 28933.7/63371: 46% mana arcane_charge(4), arcane_power, rune_of_power
1:39.799 aoe o arcane_explosion Fluffy_Pillow 33125.1/63371: 52% mana arcane_power, rune_of_power
1:41.105 aoe o arcane_explosion Fluffy_Pillow 32280.3/63371: 51% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
1:42.411 aoe o arcane_explosion Fluffy_Pillow 31435.6/63371: 50% mana arcane_charge(2), arcane_power, rune_of_power, social_butterfly
1:43.717 aoe o arcane_explosion Fluffy_Pillow 30590.8/63371: 48% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly
1:45.023 aoe p arcane_barrage Fluffy_Pillow 29746.1/63371: 47% mana arcane_charge(4), arcane_power, rune_of_power
1:46.331 aoe m arcane_orb Fluffy_Pillow 33938.8/63371: 54% mana arcane_power, rune_of_power
1:47.637 aoe p arcane_barrage Fluffy_Pillow 35344.0/63371: 56% mana arcane_charge(4), arcane_power, rune_of_power
1:48.945 aoe o arcane_explosion Fluffy_Pillow 39536.7/63371: 62% mana arcane_power, rune_of_power
1:50.253 aoe o arcane_explosion Fluffy_Pillow 38694.5/63371: 61% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
1:51.560 aoe o arcane_explosion Fluffy_Pillow 37851.0/63371: 60% mana arcane_charge(2), arcane_power, social_butterfly
1:52.867 aoe o arcane_explosion Fluffy_Pillow 37007.5/63371: 58% mana arcane_charge(3), arcane_power, social_butterfly
1:54.173 aoe l rune_of_power Fluffy_Pillow 36162.8/63371: 57% mana arcane_charge(4), social_butterfly
1:55.480 aoe p arcane_barrage Fluffy_Pillow 37819.3/63371: 60% mana arcane_charge(4), rune_of_power
1:56.787 aoe o arcane_explosion Fluffy_Pillow 42010.7/63371: 66% mana rune_of_power
1:58.092 aoe o arcane_explosion Fluffy_Pillow 38664.7/63371: 61% mana arcane_charge, rune_of_power
1:59.398 aoe o arcane_explosion Fluffy_Pillow 35320.0/63371: 56% mana arcane_charge(2), clearcasting, rune_of_power
2:00.705 aoe o arcane_explosion Fluffy_Pillow 36976.5/63371: 58% mana arcane_charge(3), rune_of_power, social_butterfly
2:02.012 aoe p arcane_barrage Fluffy_Pillow 33633.0/63371: 53% mana arcane_charge(4), rune_of_power, social_butterfly
2:03.317 aoe o arcane_explosion Fluffy_Pillow 37821.9/63371: 60% mana rune_of_power, social_butterfly
2:04.624 aoe o arcane_explosion Fluffy_Pillow 34478.4/63371: 54% mana arcane_charge, rune_of_power, social_butterfly
2:05.931 aoe o arcane_explosion Fluffy_Pillow 31134.9/63371: 49% mana arcane_charge(2), rune_of_power
2:07.238 aoe o arcane_explosion Fluffy_Pillow 27791.5/63371: 44% mana arcane_charge(3), rune_of_power
2:08.544 aoe n shifting_power Fluffy_Pillow 24446.7/63371: 39% mana arcane_charge(4), clearcasting
2:12.288 aoe p arcane_barrage Fluffy_Pillow 26692.0/63371: 42% mana arcane_charge(4), clearcasting(2), social_butterfly
2:13.595 aoe m arcane_orb Fluffy_Pillow 30883.4/63371: 49% mana clearcasting(2), social_butterfly
2:14.903 aoe p arcane_barrage Fluffy_Pillow 32041.2/63371: 51% mana arcane_charge(4), clearcasting(2), social_butterfly
2:16.211 aoe o arcane_explosion Fluffy_Pillow 36233.8/63371: 57% mana clearcasting(2)
2:17.516 aoe o arcane_explosion Fluffy_Pillow 37887.8/63371: 60% mana arcane_charge, clearcasting
2:18.823 aoe o arcane_explosion Fluffy_Pillow 39544.3/63371: 62% mana arcane_charge(2)
2:20.129 aoe o arcane_explosion Fluffy_Pillow 36199.6/63371: 57% mana arcane_charge(3), social_butterfly
2:21.437 aoe p arcane_barrage Fluffy_Pillow 32857.4/63371: 52% mana arcane_charge(4), social_butterfly
2:22.744 aoe o arcane_explosion Fluffy_Pillow 37048.8/63371: 58% mana social_butterfly
2:24.051 shared_cds r use_mana_gem NightFae_Dream_SB 33705.3/63371: 53% mana arcane_charge, social_butterfly
2:24.051 aoe o arcane_explosion Fluffy_Pillow 40042.5/63371: 63% mana arcane_charge, social_butterfly
2:25.356 aoe o arcane_explosion Fluffy_Pillow 36696.4/63371: 58% mana arcane_charge(2)
2:26.663 aoe o arcane_explosion Fluffy_Pillow 33353.0/63371: 53% mana arcane_charge(3)
2:27.969 aoe p arcane_barrage Fluffy_Pillow 30008.2/63371: 47% mana arcane_charge(4)
2:29.276 aoe j touch_of_the_magi Fluffy_Pillow 34199.6/63371: 54% mana
2:30.582 aoe l rune_of_power Fluffy_Pillow 33354.9/63371: 53% mana arcane_charge(4), social_butterfly
2:31.889 aoe p arcane_barrage Fluffy_Pillow 35011.4/63371: 55% mana arcane_charge(4), rune_of_power, social_butterfly
2:33.194 aoe o arcane_explosion Fluffy_Pillow 39200.3/63371: 62% mana rune_of_power, social_butterfly
2:34.500 aoe o arcane_explosion Fluffy_Pillow 35855.5/63371: 57% mana arcane_charge, rune_of_power, social_butterfly
2:35.806 aoe o arcane_explosion Fluffy_Pillow 32510.8/63371: 51% mana arcane_charge(2), rune_of_power
2:37.113 aoe o arcane_explosion Fluffy_Pillow 29167.3/63371: 46% mana arcane_charge(3), rune_of_power
2:38.418 aoe p arcane_barrage Fluffy_Pillow 25821.3/63371: 41% mana arcane_charge(4), rune_of_power
2:39.724 aoe m arcane_orb Fluffy_Pillow 30011.4/63371: 47% mana rune_of_power
2:41.028 aoe p arcane_barrage Fluffy_Pillow 31164.2/63371: 49% mana arcane_charge(4), rune_of_power, social_butterfly
2:42.334 aoe o arcane_explosion Fluffy_Pillow 35354.3/63371: 56% mana rune_of_power, social_butterfly
2:43.641 aoe o arcane_explosion Fluffy_Pillow 32010.8/63371: 51% mana arcane_charge, rune_of_power, social_butterfly
2:44.946 aoe o arcane_explosion Fluffy_Pillow 28664.8/63371: 45% mana arcane_charge(2), social_butterfly
2:46.253 aoe o arcane_explosion Fluffy_Pillow 25321.3/63371: 40% mana arcane_charge(3)
2:47.559 aoe p arcane_barrage Fluffy_Pillow 21976.6/63371: 35% mana arcane_charge(4), clearcasting
2:48.867 aoe o arcane_explosion Fluffy_Pillow 26169.2/63371: 41% mana clearcasting
2:50.171 aoe o arcane_explosion Fluffy_Pillow 27822.0/63371: 44% mana arcane_charge, social_butterfly
2:51.477 aoe o arcane_explosion Fluffy_Pillow 24477.2/63371: 39% mana arcane_charge(2), social_butterfly
2:52.785 aoe o arcane_explosion Fluffy_Pillow 21135.0/63371: 33% mana arcane_charge(3), social_butterfly
2:54.091 aoe n shifting_power Fluffy_Pillow 17790.3/63371: 28% mana arcane_charge(4), clearcasting, social_butterfly
2:57.709 aoe p arcane_barrage Fluffy_Pillow 19875.8/63371: 31% mana arcane_charge(4), clearcasting
2:59.015 aoe m arcane_orb Fluffy_Pillow 24066.0/63371: 38% mana clearcasting
3:00.322 aoe p arcane_barrage Fluffy_Pillow 25222.5/63371: 40% mana arcane_charge(4), clearcasting, social_butterfly
3:01.629 aoe o arcane_explosion Fluffy_Pillow 29413.9/63371: 46% mana clearcasting, social_butterfly
3:02.936 aoe o arcane_explosion Fluffy_Pillow 31070.4/63371: 49% mana arcane_charge, social_butterfly
3:04.244 aoe o arcane_explosion Fluffy_Pillow 27728.2/63371: 44% mana arcane_charge(2), social_butterfly
3:05.552 aoe o arcane_explosion Fluffy_Pillow 24386.0/63371: 38% mana arcane_charge(3)
3:06.860 aoe p arcane_barrage Fluffy_Pillow 21043.8/63371: 33% mana arcane_charge(4)
3:08.166 aoe o arcane_explosion Fluffy_Pillow 25233.9/63371: 40% mana
3:09.471 aoe o arcane_explosion Fluffy_Pillow 21887.9/63371: 35% mana arcane_charge
3:10.778 aoe o arcane_explosion Fluffy_Pillow 18544.4/63371: 29% mana arcane_charge(2), social_butterfly
3:12.084 aoe o arcane_explosion Fluffy_Pillow 15199.7/63371: 24% mana arcane_charge(3), social_butterfly
3:13.389 aoe p arcane_barrage Fluffy_Pillow 11853.7/63371: 19% mana arcane_charge(4), social_butterfly
3:14.695 aoe j touch_of_the_magi Fluffy_Pillow 16043.8/63371: 25% mana social_butterfly
3:16.002 aoe k arcane_power Fluffy_Pillow 15200.3/63371: 24% mana arcane_charge(4)
3:16.002 shared_cds t berserking Fluffy_Pillow 15200.3/63371: 24% mana arcane_charge(4), arcane_power, rune_of_power
3:16.002 aoe p arcane_barrage Fluffy_Pillow 15200.3/63371: 24% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.190 aoe o arcane_explosion Fluffy_Pillow 19240.9/63371: 30% mana berserking, arcane_power, rune_of_power
3:18.378 aoe o arcane_explosion Fluffy_Pillow 18246.6/63371: 29% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.567 aoe o arcane_explosion Fluffy_Pillow 17253.6/63371: 27% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.754 aoe o arcane_explosion Fluffy_Pillow 16258.0/63371: 26% mana berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly
3:21.944 aoe p arcane_barrage Fluffy_Pillow 15266.3/63371: 24% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, social_butterfly
3:23.132 aoe m arcane_orb Fluffy_Pillow 19306.8/63371: 30% mana berserking, arcane_power, clearcasting, rune_of_power, social_butterfly
3:24.318 aoe p arcane_barrage Fluffy_Pillow 20560.0/63371: 32% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, social_butterfly
3:25.507 aoe o arcane_explosion Fluffy_Pillow 24601.8/63371: 39% mana berserking, arcane_power, clearcasting, rune_of_power
3:26.695 aoe o arcane_explosion Fluffy_Pillow 26107.5/63371: 41% mana berserking, arcane_charge, arcane_power, rune_of_power
3:27.882 aoe o arcane_explosion Fluffy_Pillow 25112.0/63371: 40% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:29.072 aoe o arcane_explosion Fluffy_Pillow 24120.2/63371: 38% mana arcane_charge(3), arcane_power
3:30.377 aoe l rune_of_power Fluffy_Pillow 23274.2/63371: 37% mana arcane_charge(4), arcane_power, social_butterfly
3:31.683 aoe p arcane_barrage Fluffy_Pillow 24929.5/63371: 39% mana arcane_charge(4), rune_of_power, social_butterfly
3:32.991 aoe o arcane_explosion Fluffy_Pillow 29122.1/63371: 46% mana rune_of_power, social_butterfly
3:34.298 aoe o arcane_explosion Fluffy_Pillow 25778.6/63371: 41% mana arcane_charge, rune_of_power, social_butterfly
3:35.604 aoe o arcane_explosion Fluffy_Pillow 22433.9/63371: 35% mana arcane_charge(2), rune_of_power
3:36.909 aoe o arcane_explosion Fluffy_Pillow 19087.9/63371: 30% mana arcane_charge(3), rune_of_power
3:38.215 aoe p arcane_barrage Fluffy_Pillow 15743.2/63371: 25% mana arcane_charge(4), rune_of_power
3:39.521 aoe o arcane_explosion Fluffy_Pillow 19933.3/63371: 31% mana rune_of_power
3:40.829 aoe o arcane_explosion Fluffy_Pillow 16591.1/63371: 26% mana arcane_charge, clearcasting, rune_of_power, social_butterfly
3:42.136 aoe o arcane_explosion Fluffy_Pillow 18247.6/63371: 29% mana arcane_charge(2), rune_of_power, social_butterfly
3:43.441 aoe o arcane_explosion Fluffy_Pillow 14901.6/63371: 24% mana arcane_charge(3), rune_of_power, social_butterfly
3:44.747 aoe n shifting_power Fluffy_Pillow 11556.9/63371: 18% mana arcane_charge(4), social_butterfly
3:48.433 aoe p arcane_barrage Fluffy_Pillow 13728.6/63371: 22% mana arcane_charge(4)
3:49.740 aoe m arcane_orb Fluffy_Pillow 17920.0/63371: 28% mana
3:51.047 aoe p arcane_barrage Fluffy_Pillow 19076.5/63371: 30% mana arcane_charge(4), social_butterfly
3:52.354 aoe o arcane_explosion Fluffy_Pillow 23267.9/63371: 37% mana social_butterfly
3:53.660 aoe o arcane_explosion Fluffy_Pillow 19923.2/63371: 31% mana arcane_charge, social_butterfly
3:54.967 aoe o arcane_explosion Fluffy_Pillow 16579.7/63371: 26% mana arcane_charge(2), social_butterfly
3:56.273 aoe o arcane_explosion Fluffy_Pillow 13235.0/63371: 21% mana arcane_charge(3)
3:57.580 aoe p arcane_barrage Fluffy_Pillow 9891.5/63371: 16% mana arcane_charge(4)
3:58.885 aoe o arcane_explosion Fluffy_Pillow 14080.3/63371: 22% mana
4:00.192 aoe o arcane_explosion Fluffy_Pillow 10736.9/63371: 17% mana arcane_charge, social_butterfly
4:01.499 aoe o arcane_explosion Fluffy_Pillow 7393.4/63371: 12% mana arcane_charge(2), social_butterfly
4:02.807 aoe q evocation NightFae_Dream_SB 4051.2/63371: 6% mana arcane_charge(3), social_butterfly
4:07.152 aoe o arcane_explosion Fluffy_Pillow 57897.1/63371: 91% mana arcane_charge(3)
4:08.457 aoe p arcane_barrage Fluffy_Pillow 54551.1/63371: 86% mana arcane_charge(4)
4:09.765 aoe j touch_of_the_magi Fluffy_Pillow 58743.8/63371: 93% mana
4:11.072 aoe l rune_of_power Fluffy_Pillow 57900.3/63371: 91% mana arcane_charge(4), social_butterfly
4:12.378 aoe p arcane_barrage Fluffy_Pillow 59555.6/63371: 94% mana arcane_charge(4), rune_of_power, social_butterfly
4:13.684 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, social_butterfly
4:14.992 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power, social_butterfly
4:16.299 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
4:17.605 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, clearcasting, rune_of_power
4:18.912 aoe o arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2), rune_of_power
4:20.220 aoe o arcane_explosion Fluffy_Pillow 58341.0/63371: 92% mana arcane_charge(3), rune_of_power, social_butterfly
4:21.527 aoe p arcane_barrage Fluffy_Pillow 54997.5/63371: 87% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
4:22.833 aoe o arcane_explosion Fluffy_Pillow 59187.7/63371: 93% mana clearcasting, rune_of_power, social_butterfly
4:24.139 aoe o arcane_explosion Fluffy_Pillow 60842.9/63371: 96% mana arcane_charge, rune_of_power, social_butterfly
4:25.447 aoe o arcane_explosion Fluffy_Pillow 57500.7/63371: 91% mana arcane_charge(2)
4:26.756 aoe o arcane_explosion Fluffy_Pillow 54159.8/63371: 85% mana arcane_charge(3)
4:28.064 shared_cds r use_mana_gem NightFae_Dream_SB 50817.6/63371: 80% mana arcane_charge(4)
4:28.064 aoe p arcane_barrage Fluffy_Pillow 57154.7/63371: 90% mana arcane_charge(4)
4:29.369 aoe o arcane_explosion Fluffy_Pillow 61343.6/63371: 97% mana
4:30.675 aoe n shifting_power Fluffy_Pillow 57998.8/63371: 92% mana arcane_charge, clearcasting, social_butterfly
4:34.430 aoe o arcane_explosion Fluffy_Pillow 60258.0/63371: 95% mana arcane_charge, clearcasting, social_butterfly
4:35.736 aoe o arcane_explosion Fluffy_Pillow 61913.3/63371: 98% mana arcane_charge(2)
4:37.043 aoe o arcane_explosion Fluffy_Pillow 58569.8/63371: 92% mana arcane_charge(3)
4:38.349 aoe p arcane_barrage Fluffy_Pillow 55225.1/63371: 87% mana arcane_charge(4)
4:39.654 aoe m arcane_orb Fluffy_Pillow 59413.9/63371: 94% mana
4:40.961 aoe p arcane_barrage Fluffy_Pillow 60570.5/63371: 96% mana arcane_charge(4), social_butterfly
4:42.267 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana social_butterfly
4:43.575 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge, social_butterfly
4:44.882 aoe o arcane_explosion Fluffy_Pillow 56685.8/63371: 89% mana arcane_charge(2), clearcasting, social_butterfly
4:46.190 aoe o arcane_explosion Fluffy_Pillow 58343.6/63371: 92% mana arcane_charge(3)
4:47.496 aoe p arcane_barrage Fluffy_Pillow 54998.8/63371: 87% mana arcane_charge(4)
4:48.803 aoe o arcane_explosion Fluffy_Pillow 59190.2/63371: 93% mana
4:50.109 aoe o arcane_explosion Fluffy_Pillow 55845.5/63371: 88% mana arcane_charge, social_butterfly
4:51.416 aoe j touch_of_the_magi Fluffy_Pillow 52502.0/63371: 83% mana arcane_charge(2), social_butterfly
4:52.724 aoe k arcane_power Fluffy_Pillow 51659.8/63371: 82% mana arcane_charge(4), social_butterfly
4:52.724 aoe p arcane_barrage Fluffy_Pillow 51659.8/63371: 82% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
4:54.031 aoe o arcane_explosion Fluffy_Pillow 55851.2/63371: 88% mana arcane_power, rune_of_power, social_butterfly
4:55.338 aoe o arcane_explosion Fluffy_Pillow 55007.7/63371: 87% mana arcane_charge, arcane_power, rune_of_power
4:56.644 aoe o arcane_explosion Fluffy_Pillow 54163.0/63371: 85% mana arcane_charge(2), arcane_power, rune_of_power
4:57.949 aoe o arcane_explosion Fluffy_Pillow 53317.0/63371: 84% mana arcane_charge(3), arcane_power, rune_of_power
4:59.256 aoe p arcane_barrage Fluffy_Pillow 52473.5/63371: 83% mana arcane_charge(4), arcane_power, rune_of_power
5:00.563 aoe m arcane_orb Fluffy_Pillow 56664.9/63371: 89% mana arcane_power, rune_of_power, social_butterfly
5:01.871 shared_cds s potion Fluffy_Pillow 58072.7/63371: 92% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
5:01.871 aoe p arcane_barrage Fluffy_Pillow 58072.7/63371: 92% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:03.178 aoe o arcane_explosion Fluffy_Pillow 62264.1/63371: 98% mana arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:04.485 aoe o arcane_explosion Fluffy_Pillow 61420.6/63371: 97% mana arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:05.790 aoe o arcane_explosion Fluffy_Pillow 60574.6/63371: 96% mana arcane_charge(2), arcane_power, potion_of_deathly_fixation
5:07.096 aoe o arcane_explosion Fluffy_Pillow 59729.8/63371: 94% mana arcane_charge(3), arcane_power, potion_of_deathly_fixation
5:08.401 aoe l rune_of_power Fluffy_Pillow 58883.8/63371: 93% mana arcane_charge(4), potion_of_deathly_fixation
5:09.708 aoe p arcane_barrage Fluffy_Pillow 60540.4/63371: 96% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:11.016 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, social_butterfly, potion_of_deathly_fixation
5:12.322 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:13.627 aoe o arcane_explosion Fluffy_Pillow 56680.7/63371: 89% mana arcane_charge(2), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:14.935 aoe o arcane_explosion Fluffy_Pillow 53338.5/63371: 84% mana arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:16.241 aoe p arcane_barrage Fluffy_Pillow 49993.7/63371: 79% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.549 aoe o arcane_explosion Fluffy_Pillow 54186.4/63371: 86% mana rune_of_power, potion_of_deathly_fixation
5:18.854 aoe o arcane_explosion Fluffy_Pillow 50840.4/63371: 80% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:20.160 aoe o arcane_explosion Fluffy_Pillow 47495.7/63371: 75% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:21.466 aoe o arcane_explosion Fluffy_Pillow 49150.9/63371: 78% mana arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:22.774 aoe n shifting_power Fluffy_Pillow 45808.7/63371: 72% mana arcane_charge(4), social_butterfly, potion_of_deathly_fixation
5:26.546 aoe p arcane_barrage Fluffy_Pillow 48089.5/63371: 76% mana arcane_charge(4), potion_of_deathly_fixation
5:27.852 aoe m arcane_orb Fluffy_Pillow 52279.6/63371: 82% mana
5:29.159 aoe p arcane_barrage Fluffy_Pillow 53436.1/63371: 84% mana arcane_charge(4)
5:30.465 aoe o arcane_explosion Fluffy_Pillow 57626.2/63371: 91% mana social_butterfly
5:31.772 aoe o arcane_explosion Fluffy_Pillow 54282.7/63371: 86% mana arcane_charge, social_butterfly
5:33.078 aoe o arcane_explosion Fluffy_Pillow 50938.0/63371: 80% mana arcane_charge(2), social_butterfly
5:34.382 aoe o arcane_explosion Fluffy_Pillow 47590.7/63371: 75% mana arcane_charge(3), social_butterfly
5:35.688 aoe p arcane_barrage Fluffy_Pillow 44246.0/63371: 70% mana arcane_charge(4)
5:36.995 aoe o arcane_explosion Fluffy_Pillow 48437.4/63371: 76% mana
5:38.301 aoe o arcane_explosion Fluffy_Pillow 45092.6/63371: 71% mana arcane_charge
5:39.608 aoe o arcane_explosion Fluffy_Pillow 41749.2/63371: 66% mana arcane_charge(2)
5:40.916 aoe o arcane_explosion Fluffy_Pillow 38407.0/63371: 61% mana arcane_charge(3), social_butterfly
5:42.223 aoe p arcane_barrage Fluffy_Pillow 35063.5/63371: 55% mana arcane_charge(4), social_butterfly
5:43.531 aoe j touch_of_the_magi Fluffy_Pillow 39256.2/63371: 62% mana social_butterfly
5:44.838 aoe l rune_of_power Fluffy_Pillow 38412.7/63371: 61% mana arcane_charge(4), social_butterfly
5:46.144 aoe p arcane_barrage Fluffy_Pillow 40067.9/63371: 63% mana arcane_charge(4), rune_of_power
5:47.450 aoe o arcane_explosion Fluffy_Pillow 44258.1/63371: 70% mana rune_of_power
5:48.757 aoe o arcane_explosion Fluffy_Pillow 40914.6/63371: 65% mana arcane_charge, rune_of_power
5:50.065 aoe o arcane_explosion Fluffy_Pillow 37572.4/63371: 59% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
5:51.374 aoe o arcane_explosion Fluffy_Pillow 39231.5/63371: 62% mana arcane_charge(3), rune_of_power, social_butterfly
5:52.681 aoe p arcane_barrage Fluffy_Pillow 35888.0/63371: 57% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
5:53.988 aoe m arcane_orb Fluffy_Pillow 40079.4/63371: 63% mana clearcasting, rune_of_power, social_butterfly

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream_SB"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=319210//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Koraylon : 11200 dps, 4726 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11199.9 11199.9 14.4 / 0.129% 999.1 / 8.9% 5.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
1888.8 1781.6 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Koraylon 11200
Arcane Barrage 3981 35.5% 54.4 5.53sec 21945 17726 Direct 162.9 6149 12277 7329 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.37 162.87 0.00 0.00 1.2380 0.0000 1193158.09 1193158.09 0.00% 17725.52 17725.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 131.55 94 167 6149.25 2082 25140 6147.96 5479 6710 808597 808597 0.00%
crit 19.23% 31.33 14 55 12276.62 4164 50280 12298.63 8420 18022 384561 384561 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.37
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 296 2.6% 41.3 6.94sec 2146 0 Direct 123.8 599 1198 715 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.26 123.78 0.00 0.00 0.0000 0.0000 88550.05 88550.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 99.78 69 128 599.37 443 731 599.59 573 630 59803 59803 0.00%
crit 19.38% 23.99 9 41 1198.27 886 1462 1198.74 999 1351 28747 28747 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4610 41.2% 142.5 2.08sec 9702 7797 Direct 427.4 2709 5417 3234 19.4%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.46 427.37 0.00 0.00 1.2443 0.0000 1382164.52 1382164.52 0.00% 7797.43 7797.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 344.44 265 422 2708.65 1958 4523 2709.30 2597 2789 932988 932988 0.00%
crit 19.40% 82.92 46 123 5416.81 3916 9045 5416.63 4926 6121 449176 449176 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.45
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (895) 0.0% (8.0%) 13.4 22.92sec 19994 16334

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.42 0.00 0.00 0.00 1.2241 0.0000 0.00 0.00 0.00% 16333.77 16333.77

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.42
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 895 8.0% 40.2 22.92sec 6674 0 Direct 40.2 5596 11230 6672 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.20 40.20 0.00 0.00 0.0000 0.0000 268249.56 268249.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 32.52 21 47 5595.80 3869 8938 5597.83 4943 6105 182034 182034 0.00%
crit 19.09% 7.67 1 19 11230.44 7739 17876 11249.85 7739 17064 86215 86215 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (92) 0.0% (0.8%) 18.8 9.70sec 1496 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 92 0.8% 18.8 9.70sec 1496 0 Direct 18.8 1254 2507 1496 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.76 18.76 0.00 0.00 0.0000 0.0000 28065.39 28065.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 15.13 5 29 1253.68 1164 1280 1259.37 1202 1280 18969 18969 0.00%
crit 19.34% 3.63 0 11 2506.74 2327 2560 2425.60 0 2560 9096 9096 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 7 0.1% 0.0 0.00sec 0 0 Direct 1.0 1629 3257 1962 20.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1961.99 1961.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 0.80 0 1 1628.74 1629 1629 1295.50 0 1629 1296 1296 0.00%
crit 20.46% 0.20 0 1 3257.49 3257 3257 666.49 0 3257 666 666 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5788 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.2% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5787.63 5787.63 0.00% 49.14 49.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 72.66 62 84 53.95 43 60 53.95 53 56 3920 3920 0.00%
crit 19.27% 17.34 6 28 107.69 86 120 107.71 96 120 1868 1868 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 404 3.6% 6.1 48.44sec 20042 5611 Periodic 72.2 1405 2809 1679 19.6% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 24.07 72.22 3.5721 0.8348 121288.88 121288.88 0.00% 5610.81 5610.81
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.45% 58.10 39 77 1404.88 1372 1510 1404.44 1388 1426 81631 81631 0.00%
crit 19.55% 14.12 4 30 2808.53 2745 3019 2807.55 2745 2928 39658 39658 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.05
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (896) 0.0% (8.0%) 6.6 48.82sec 40390 30918

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.63 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 30917.76 30917.76

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.68
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 896 8.0% 6.6 48.68sec 40390 0 Direct 19.8 13543 0 13543 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.63 19.80 0.00 0.00 0.0000 0.0000 267964.22 267964.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.80 15 24 13542.92 3377 49190 13571.79 11481 17448 267964 267964 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16960.20
  • base_dd_max:16960.20
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Koraylon
Arcane Power 3.6 97.18sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.74sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.2 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.23 0.00 1.38 0.00 4.2710 0.7213 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.24
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.43sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.48
  • if_expr:buff.arcane_power.up
Rune of Power 6.5 47.11sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.49 0.00 0.00 0.00 1.2602 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.51
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.60sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.80
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.1 147.6 5.5sec 1.5sec 4.1sec 75.60% 0.00% 2.1 (3.2) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.7s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.11%
  • arcane_charge_2:15.58%
  • arcane_charge_3:14.63%
  • arcane_charge_4:27.28%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.0s
  • trigger_min/max:96.0s / 102.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.11% 23.66% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.6s / 199.3s
  • trigger_min/max:192.6s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.4 0.2 13.0sec 12.8sec 2.2sec 16.74% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.38%
  • clearcasting_2:0.37%
  • clearcasting_3:0.04%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.2 0.0 0.0sec 0.0sec 4.3sec 0.33% 0.00% 0.9 (0.9) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:0.33%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.4sec 11.35% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.35%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.1sec 31.1sec 11.8sec 39.36% 0.00% 0.0 (0.0) 9.6

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.8s
  • trigger_min/max:14.4s / 48.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.36%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.63% 0.76% 5.73% 0.9s 0.0s 3.9s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.091144.122263.871
Evocation236.05393.318351.415287.725176.974359.871
Rune of Power13.4730.00431.47790.57472.365109.184
Touch of the Magi12.2320.00021.61584.09268.086107.088
Arcane Power1.2190.0046.0474.3382.1348.995
Arcane Barrage3.0310.00212.251166.096132.754200.162
Arcane Orb4.2500.00011.69557.77235.61777.209
Shifting Power7.8630.00030.23347.86043.23257.027

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Koraylon
mana_regen Mana 691.68 372578.79 69.67% 538.65 7211.18 1.90%
Evocation Mana 11.14 11201.68 2.09% 1005.51 0.00 0.00%
Mana Gem Mana 2.80 17741.94 3.32% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.37 133229.33 24.91% 2450.24 4600.70 3.34%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1781.61 1888.80 11795.3 31206.0 1900.3 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Koraylon
arcane_explosion Mana 142.4 528300.9 3708.7 3708.5 2.6
arcane_orb Mana 13.4 5837.8 435.2 435.1 46.0
shifting_power Mana 6.1 15127.7 2500.0 2499.7 8.0
touch_of_the_magi Mana 6.6 16597.7 2500.0 2501.8 16.1

Statistics & Data Analysis

Fight Length
NightFae_Koraylon Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
NightFae_Koraylon Damage Per Second
Count 1217
Mean 11199.89
Minimum 10426.71
Maximum 11947.75
Spread ( max - min ) 1521.03
Range [ ( max - min ) / 2 * 100% ] 6.79%
Standard Deviation 256.4364
5th Percentile 10798.64
95th Percentile 11640.15
( 95th Percentile - 5th Percentile ) 841.51
Mean Distribution
Standard Deviation 7.3508
95.00% Confidence Interval ( 11185.48 - 11214.30 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2014
0.1 Scale Factor Error with Delta=300 562
0.05 Scale Factor Error with Delta=300 2246
0.01 Scale Factor Error with Delta=300 56137
Priority Target DPS
NightFae_Koraylon Priority Target Damage Per Second
Count 1217
Mean 4726.33
Minimum 4232.05
Maximum 5249.45
Spread ( max - min ) 1017.39
Range [ ( max - min ) / 2 * 100% ] 10.76%
Standard Deviation 161.0346
5th Percentile 4481.52
95th Percentile 5003.64
( 95th Percentile - 5th Percentile ) 522.13
Mean Distribution
Standard Deviation 4.6161
95.00% Confidence Interval ( 4717.29 - 4735.38 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4460
0.1 Scale Factor Error with Delta=300 222
0.05 Scale Factor Error with Delta=300 886
0.01 Scale Factor Error with Delta=300 22138
DPS(e)
NightFae_Koraylon Damage Per Second (Effective)
Count 1217
Mean 11199.89
Minimum 10426.71
Maximum 11947.75
Spread ( max - min ) 1521.03
Range [ ( max - min ) / 2 * 100% ] 6.79%
Damage
NightFae_Koraylon Damage
Count 1217
Mean 3351402.69
Minimum 2643916.66
Maximum 4107218.49
Spread ( max - min ) 1463301.83
Range [ ( max - min ) / 2 * 100% ] 21.83%
DTPS
NightFae_Koraylon Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Koraylon Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Koraylon Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Koraylon Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Koraylon Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Koraylon Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_KoraylonTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Koraylon Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.68 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.51 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.42 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.05 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.45 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.37 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.24 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.80 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.48 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpooroopmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpoooorpoooopjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpooroopoooonpmpoooopoooopjkpoooopmspoooolpoooopoooonpmpoooopoooopjlpoooopm

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Koraylon 63371.4/63371: 100% mana
Pre precombat R food NightFae_Koraylon 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.305 aoe k arcane_power Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4)
0:01.305 shared_cds s potion Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.305 shared_cds t berserking Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.305 aoe p arcane_barrage Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.220 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.134 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.050 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.966 aoe o arcane_explosion Fluffy_Pillow 62032.4/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.878 aoe o arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.791 aoe o arcane_explosion Fluffy_Pillow 59345.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.705 aoe p arcane_barrage Fluffy_Pillow 58003.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.619 aoe o arcane_explosion Fluffy_Pillow 61697.2/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.533 aoe o arcane_explosion Fluffy_Pillow 60355.6/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.448 aoe o arcane_explosion Fluffy_Pillow 59015.3/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.363 aoe o arcane_explosion Fluffy_Pillow 57675.0/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.277 aoe p arcane_barrage Fluffy_Pillow 56333.4/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.191 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.106 aoe o arcane_explosion Fluffy_Pillow 58686.4/63371: 93% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:15.115 aoe o arcane_explosion Fluffy_Pillow 57465.2/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.123 aoe o arcane_explosion Fluffy_Pillow 56242.8/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.130 aoe l rune_of_power Fluffy_Pillow 55019.1/63371: 87% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.136 aoe p arcane_barrage Fluffy_Pillow 56294.1/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.142 aoe o arcane_explosion Fluffy_Pillow 60104.0/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.149 aoe o arcane_explosion Fluffy_Pillow 56380.3/63371: 89% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.155 shared_cds r use_mana_gem NightFae_Koraylon 52655.4/63371: 83% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:21.155 aoe o arcane_explosion Fluffy_Pillow 58992.5/63371: 93% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.161 aoe o arcane_explosion Fluffy_Pillow 55267.5/63371: 87% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.167 aoe p arcane_barrage Fluffy_Pillow 51542.6/63371: 81% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.174 aoe m arcane_orb Fluffy_Pillow 55353.7/63371: 87% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.179 aoe p arcane_barrage Fluffy_Pillow 56127.5/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.186 aoe o arcane_explosion Fluffy_Pillow 59938.7/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.191 aoe o arcane_explosion Fluffy_Pillow 56212.4/63371: 89% mana bloodlust, arcane_charge, rune_of_power
0:28.197 aoe o arcane_explosion Fluffy_Pillow 52487.5/63371: 83% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:29.203 aoe o arcane_explosion Fluffy_Pillow 53762.5/63371: 85% mana bloodlust, arcane_charge(3), rune_of_power
0:30.209 aoe n shifting_power Fluffy_Pillow 50037.5/63371: 79% mana bloodlust, arcane_charge(4)
0:33.133 aoe p arcane_barrage Fluffy_Pillow 51243.5/63371: 81% mana bloodlust, arcane_charge(4)
0:34.141 aoe m arcane_orb Fluffy_Pillow 55055.9/63371: 87% mana bloodlust
0:35.149 aoe p arcane_barrage Fluffy_Pillow 55833.5/63371: 88% mana bloodlust, arcane_charge(4)
0:36.155 aoe o arcane_explosion Fluffy_Pillow 59643.4/63371: 94% mana bloodlust
0:37.162 aoe o arcane_explosion Fluffy_Pillow 55919.7/63371: 88% mana bloodlust, arcane_charge
0:38.169 aoe o arcane_explosion Fluffy_Pillow 52196.0/63371: 82% mana bloodlust, arcane_charge(2)
0:39.176 aoe o arcane_explosion Fluffy_Pillow 48472.3/63371: 76% mana bloodlust, arcane_charge(3)
0:40.183 aoe p arcane_barrage Fluffy_Pillow 44748.6/63371: 71% mana bloodlust, arcane_charge(4), clearcasting
0:41.191 aoe o arcane_explosion Fluffy_Pillow 48561.0/63371: 77% mana clearcasting
0:42.497 aoe o arcane_explosion Fluffy_Pillow 50216.3/63371: 79% mana arcane_charge
0:43.804 aoe o arcane_explosion Fluffy_Pillow 46872.8/63371: 74% mana arcane_charge(2), clearcasting
0:45.110 aoe o arcane_explosion Fluffy_Pillow 48528.0/63371: 77% mana arcane_charge(3)
0:46.416 aoe p arcane_barrage Fluffy_Pillow 45183.3/63371: 71% mana arcane_charge(4), clearcasting
0:47.722 aoe o arcane_explosion Fluffy_Pillow 49373.4/63371: 78% mana clearcasting
0:49.029 aoe o arcane_explosion Fluffy_Pillow 51030.0/63371: 81% mana arcane_charge
0:50.335 aoe j touch_of_the_magi Fluffy_Pillow 47685.2/63371: 75% mana arcane_charge(2)
0:51.642 aoe l rune_of_power Fluffy_Pillow 46841.7/63371: 74% mana arcane_charge(4)
0:52.948 aoe p arcane_barrage Fluffy_Pillow 48497.0/63371: 77% mana arcane_charge(4), rune_of_power
0:54.255 aoe m arcane_orb Fluffy_Pillow 52688.4/63371: 83% mana rune_of_power
0:55.559 aoe p arcane_barrage Fluffy_Pillow 53841.1/63371: 85% mana arcane_charge(4), rune_of_power
0:56.865 aoe o arcane_explosion Fluffy_Pillow 58031.2/63371: 92% mana rune_of_power
0:58.170 aoe o arcane_explosion Fluffy_Pillow 54685.2/63371: 86% mana arcane_charge, rune_of_power
0:59.477 aoe o arcane_explosion Fluffy_Pillow 51341.8/63371: 81% mana arcane_charge(2), rune_of_power
1:00.784 aoe o arcane_explosion Fluffy_Pillow 47998.3/63371: 76% mana arcane_charge(3), clearcasting, rune_of_power
1:02.091 aoe p arcane_barrage Fluffy_Pillow 49654.8/63371: 78% mana arcane_charge(4), rune_of_power
1:03.398 aoe o arcane_explosion Fluffy_Pillow 53846.2/63371: 85% mana rune_of_power
1:04.705 aoe o arcane_explosion Fluffy_Pillow 50502.7/63371: 80% mana arcane_charge, clearcasting, rune_of_power
1:06.011 aoe o arcane_explosion Fluffy_Pillow 52158.0/63371: 82% mana arcane_charge(2)
1:07.318 aoe o arcane_explosion Fluffy_Pillow 48814.5/63371: 77% mana arcane_charge(3), clearcasting
1:08.624 aoe p arcane_barrage Fluffy_Pillow 50469.8/63371: 80% mana arcane_charge(4)
1:09.930 aoe o arcane_explosion Fluffy_Pillow 54659.9/63371: 86% mana
1:11.236 aoe o arcane_explosion Fluffy_Pillow 51315.2/63371: 81% mana arcane_charge
1:12.542 aoe o arcane_explosion Fluffy_Pillow 47970.4/63371: 76% mana arcane_charge(2)
1:13.849 aoe o arcane_explosion Fluffy_Pillow 44627.0/63371: 70% mana arcane_charge(3), clearcasting
1:15.156 aoe n shifting_power Fluffy_Pillow 46283.5/63371: 73% mana arcane_charge(4)
1:18.923 aoe p arcane_barrage Fluffy_Pillow 48557.9/63371: 77% mana arcane_charge(4)
1:20.229 aoe m arcane_orb Fluffy_Pillow 52748.0/63371: 83% mana
1:21.535 aoe p arcane_barrage Fluffy_Pillow 53903.3/63371: 85% mana arcane_charge(4)
1:22.843 aoe o arcane_explosion Fluffy_Pillow 58095.9/63371: 92% mana
1:24.150 aoe o arcane_explosion Fluffy_Pillow 54752.5/63371: 86% mana arcane_charge
1:25.457 aoe o arcane_explosion Fluffy_Pillow 51409.0/63371: 81% mana arcane_charge(2)
1:26.764 aoe o arcane_explosion Fluffy_Pillow 48065.5/63371: 76% mana arcane_charge(3), clearcasting
1:28.071 aoe p arcane_barrage Fluffy_Pillow 49722.0/63371: 78% mana arcane_charge(4)
1:29.377 aoe o arcane_explosion Fluffy_Pillow 53912.2/63371: 85% mana
1:30.685 aoe o arcane_explosion Fluffy_Pillow 50570.0/63371: 80% mana arcane_charge, clearcasting
1:31.992 aoe o arcane_explosion Fluffy_Pillow 52226.5/63371: 82% mana arcane_charge(2)
1:33.299 aoe o arcane_explosion Fluffy_Pillow 48883.0/63371: 77% mana arcane_charge(3), clearcasting
1:34.606 aoe p arcane_barrage Fluffy_Pillow 50539.5/63371: 80% mana arcane_charge(4)
1:35.913 aoe o arcane_explosion Fluffy_Pillow 54730.9/63371: 86% mana
1:37.221 aoe j touch_of_the_magi Fluffy_Pillow 51388.7/63371: 81% mana arcane_charge, clearcasting
1:38.527 aoe k arcane_power Fluffy_Pillow 50544.0/63371: 80% mana arcane_charge(4), clearcasting
1:38.527 aoe p arcane_barrage Fluffy_Pillow 50544.0/63371: 80% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
1:39.834 aoe o arcane_explosion Fluffy_Pillow 54735.4/63371: 86% mana arcane_power, clearcasting, rune_of_power
1:41.140 aoe o arcane_explosion Fluffy_Pillow 56390.6/63371: 89% mana arcane_charge, arcane_power, rune_of_power
1:42.445 aoe o arcane_explosion Fluffy_Pillow 55544.6/63371: 88% mana arcane_charge(2), arcane_power, rune_of_power
1:43.751 aoe o arcane_explosion Fluffy_Pillow 54699.9/63371: 86% mana arcane_charge(3), arcane_power, rune_of_power
1:45.059 aoe p arcane_barrage Fluffy_Pillow 53857.7/63371: 85% mana arcane_charge(4), arcane_power, rune_of_power
1:46.366 aoe m arcane_orb Fluffy_Pillow 58049.1/63371: 92% mana arcane_power, rune_of_power
1:47.672 aoe p arcane_barrage Fluffy_Pillow 59454.3/63371: 94% mana arcane_charge(4), arcane_power, rune_of_power
1:48.978 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, rune_of_power
1:50.283 aoe o arcane_explosion Fluffy_Pillow 62525.4/63371: 99% mana arcane_charge, arcane_power, rune_of_power
1:51.590 aoe o arcane_explosion Fluffy_Pillow 61682.0/63371: 97% mana arcane_charge(2), arcane_power
1:52.897 aoe o arcane_explosion Fluffy_Pillow 60838.5/63371: 96% mana arcane_charge(3), arcane_power
1:54.204 aoe l rune_of_power Fluffy_Pillow 59995.0/63371: 95% mana arcane_charge(4)
1:55.511 aoe p arcane_barrage Fluffy_Pillow 61651.5/63371: 97% mana arcane_charge(4), rune_of_power
1:56.818 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
1:58.123 aoe o arcane_explosion Fluffy_Pillow 60025.4/63371: 95% mana arcane_charge, rune_of_power
1:59.429 aoe o arcane_explosion Fluffy_Pillow 56680.7/63371: 89% mana arcane_charge(2), rune_of_power
2:00.736 aoe o arcane_explosion Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(3), clearcasting, rune_of_power
2:02.042 aoe p arcane_barrage Fluffy_Pillow 54992.5/63371: 87% mana arcane_charge(4), rune_of_power
2:03.347 aoe o arcane_explosion Fluffy_Pillow 59181.3/63371: 93% mana rune_of_power
2:04.654 aoe o arcane_explosion Fluffy_Pillow 55837.9/63371: 88% mana arcane_charge, rune_of_power
2:05.960 aoe o arcane_explosion Fluffy_Pillow 52493.1/63371: 83% mana arcane_charge(2), rune_of_power
2:07.269 aoe o arcane_explosion Fluffy_Pillow 49152.2/63371: 78% mana arcane_charge(3), rune_of_power
2:08.577 aoe n shifting_power Fluffy_Pillow 45810.0/63371: 72% mana arcane_charge(4)
2:12.240 aoe p arcane_barrage Fluffy_Pillow 47952.6/63371: 76% mana arcane_charge(4)
2:13.546 aoe m arcane_orb Fluffy_Pillow 52142.7/63371: 82% mana
2:14.852 aoe p arcane_barrage Fluffy_Pillow 53297.9/63371: 84% mana arcane_charge(4)
2:16.158 aoe o arcane_explosion Fluffy_Pillow 57488.1/63371: 91% mana
2:17.465 aoe o arcane_explosion Fluffy_Pillow 54144.6/63371: 85% mana arcane_charge, clearcasting
2:18.770 aoe o arcane_explosion Fluffy_Pillow 55798.6/63371: 88% mana arcane_charge(2)
2:20.076 aoe o arcane_explosion Fluffy_Pillow 52453.9/63371: 83% mana arcane_charge(3)
2:21.383 shared_cds r use_mana_gem NightFae_Koraylon 49110.4/63371: 77% mana arcane_charge(4)
2:21.383 aoe p arcane_barrage Fluffy_Pillow 55447.5/63371: 87% mana arcane_charge(4)
2:22.690 aoe o arcane_explosion Fluffy_Pillow 59638.9/63371: 94% mana
2:23.997 aoe o arcane_explosion Fluffy_Pillow 56295.4/63371: 89% mana arcane_charge
2:25.304 aoe o arcane_explosion Fluffy_Pillow 52952.0/63371: 84% mana arcane_charge(2)
2:26.608 aoe o arcane_explosion Fluffy_Pillow 49604.7/63371: 78% mana arcane_charge(3), clearcasting
2:27.915 aoe p arcane_barrage Fluffy_Pillow 51261.2/63371: 81% mana arcane_charge(4)
2:29.221 aoe j touch_of_the_magi Fluffy_Pillow 55451.3/63371: 88% mana
2:30.529 aoe l rune_of_power Fluffy_Pillow 54609.1/63371: 86% mana arcane_charge(4)
2:31.835 aoe p arcane_barrage Fluffy_Pillow 56264.4/63371: 89% mana arcane_charge(4), rune_of_power
2:33.140 aoe o arcane_explosion Fluffy_Pillow 60453.3/63371: 95% mana rune_of_power
2:34.444 aoe o arcane_explosion Fluffy_Pillow 57106.0/63371: 90% mana arcane_charge, rune_of_power
2:35.749 aoe o arcane_explosion Fluffy_Pillow 53760.0/63371: 85% mana arcane_charge(2), rune_of_power
2:37.055 aoe o arcane_explosion Fluffy_Pillow 50415.2/63371: 80% mana arcane_charge(3), rune_of_power
2:38.361 aoe p arcane_barrage Fluffy_Pillow 47070.5/63371: 74% mana arcane_charge(4), rune_of_power
2:39.667 aoe m arcane_orb Fluffy_Pillow 51260.6/63371: 81% mana rune_of_power
2:40.976 aoe p arcane_barrage Fluffy_Pillow 52419.7/63371: 83% mana arcane_charge(4), rune_of_power
2:42.282 aoe o arcane_explosion Fluffy_Pillow 56609.8/63371: 89% mana rune_of_power
2:43.588 aoe o arcane_explosion Fluffy_Pillow 53265.1/63371: 84% mana arcane_charge, clearcasting, rune_of_power
2:44.894 aoe o arcane_explosion Fluffy_Pillow 54920.3/63371: 87% mana arcane_charge(2)
2:46.201 aoe o arcane_explosion Fluffy_Pillow 51576.9/63371: 81% mana arcane_charge(3), clearcasting
2:47.506 aoe p arcane_barrage Fluffy_Pillow 53230.8/63371: 84% mana arcane_charge(4)
2:48.812 aoe o arcane_explosion Fluffy_Pillow 57421.0/63371: 91% mana
2:50.119 aoe o arcane_explosion Fluffy_Pillow 54077.5/63371: 85% mana arcane_charge
2:51.426 aoe o arcane_explosion Fluffy_Pillow 50734.0/63371: 80% mana arcane_charge(2)
2:52.733 aoe o arcane_explosion Fluffy_Pillow 47390.6/63371: 75% mana arcane_charge(3)
2:54.039 aoe n shifting_power Fluffy_Pillow 44045.8/63371: 70% mana arcane_charge(4)
2:57.809 aoe p arcane_barrage Fluffy_Pillow 46324.0/63371: 73% mana arcane_charge(4)
2:59.115 aoe m arcane_orb Fluffy_Pillow 50514.1/63371: 80% mana
3:00.423 aoe p arcane_barrage Fluffy_Pillow 51671.9/63371: 82% mana arcane_charge(4)
3:01.730 aoe o arcane_explosion Fluffy_Pillow 55863.3/63371: 88% mana
3:03.036 aoe o arcane_explosion Fluffy_Pillow 52518.6/63371: 83% mana arcane_charge
3:04.343 aoe o arcane_explosion Fluffy_Pillow 49175.1/63371: 78% mana arcane_charge(2)
3:05.649 aoe o arcane_explosion Fluffy_Pillow 45830.4/63371: 72% mana arcane_charge(3)
3:06.955 aoe p arcane_barrage Fluffy_Pillow 42485.6/63371: 67% mana arcane_charge(4)
3:08.262 aoe o arcane_explosion Fluffy_Pillow 46677.0/63371: 74% mana
3:09.568 aoe o arcane_explosion Fluffy_Pillow 43332.3/63371: 68% mana arcane_charge
3:10.874 aoe o arcane_explosion Fluffy_Pillow 39987.5/63371: 63% mana arcane_charge(2)
3:12.180 aoe o arcane_explosion Fluffy_Pillow 36642.8/63371: 58% mana arcane_charge(3)
3:13.487 aoe p arcane_barrage Fluffy_Pillow 33299.3/63371: 53% mana arcane_charge(4)
3:14.793 aoe j touch_of_the_magi Fluffy_Pillow 37489.5/63371: 59% mana
3:16.101 aoe k arcane_power Fluffy_Pillow 36647.3/63371: 58% mana arcane_charge(4)
3:16.101 shared_cds t berserking Fluffy_Pillow 36647.3/63371: 58% mana arcane_charge(4), arcane_power, rune_of_power
3:16.101 aoe p arcane_barrage Fluffy_Pillow 36647.3/63371: 58% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.290 aoe o arcane_explosion Fluffy_Pillow 40689.1/63371: 64% mana berserking, arcane_power, rune_of_power
3:18.478 aoe o arcane_explosion Fluffy_Pillow 39694.8/63371: 63% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.666 aoe o arcane_explosion Fluffy_Pillow 38700.5/63371: 61% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.854 aoe o arcane_explosion Fluffy_Pillow 37706.2/63371: 60% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:22.043 aoe p arcane_barrage Fluffy_Pillow 36713.2/63371: 58% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.230 aoe m arcane_orb Fluffy_Pillow 40752.5/63371: 64% mana berserking, arcane_power, rune_of_power
3:24.419 aoe p arcane_barrage Fluffy_Pillow 42009.4/63371: 66% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:25.607 aoe o arcane_explosion Fluffy_Pillow 46050.0/63371: 73% mana berserking, arcane_power, rune_of_power
3:26.796 aoe o arcane_explosion Fluffy_Pillow 45057.0/63371: 71% mana berserking, arcane_charge, arcane_power, rune_of_power
3:27.985 aoe o arcane_explosion Fluffy_Pillow 44063.9/63371: 70% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:29.174 aoe o arcane_explosion Fluffy_Pillow 43070.9/63371: 68% mana arcane_charge(3), arcane_power, clearcasting
3:30.480 aoe l rune_of_power Fluffy_Pillow 44726.2/63371: 71% mana arcane_charge(4), arcane_power
3:31.787 aoe p arcane_barrage Fluffy_Pillow 46382.7/63371: 73% mana arcane_charge(4), rune_of_power
3:33.093 aoe o arcane_explosion Fluffy_Pillow 50572.8/63371: 80% mana rune_of_power
3:34.400 aoe o arcane_explosion Fluffy_Pillow 47229.4/63371: 75% mana arcane_charge, clearcasting, rune_of_power
3:35.708 aoe o arcane_explosion Fluffy_Pillow 48887.2/63371: 77% mana arcane_charge(2), rune_of_power
3:37.015 aoe o arcane_explosion Fluffy_Pillow 45543.7/63371: 72% mana arcane_charge(3), rune_of_power
3:38.320 aoe p arcane_barrage Fluffy_Pillow 42197.7/63371: 67% mana arcane_charge(4), rune_of_power
3:39.627 aoe o arcane_explosion Fluffy_Pillow 46389.1/63371: 73% mana rune_of_power
3:40.934 aoe o arcane_explosion Fluffy_Pillow 43045.6/63371: 68% mana arcane_charge, rune_of_power
3:42.242 aoe o arcane_explosion Fluffy_Pillow 39703.4/63371: 63% mana arcane_charge(2), rune_of_power
3:43.550 aoe o arcane_explosion Fluffy_Pillow 36361.2/63371: 57% mana arcane_charge(3), rune_of_power
3:44.857 aoe n shifting_power Fluffy_Pillow 33017.7/63371: 52% mana arcane_charge(4)
3:48.550 aoe p arcane_barrage Fluffy_Pillow 35198.3/63371: 56% mana arcane_charge(4)
3:49.855 aoe m arcane_orb Fluffy_Pillow 39387.2/63371: 62% mana
3:51.163 aoe p arcane_barrage Fluffy_Pillow 40545.0/63371: 64% mana arcane_charge(4)
3:52.469 aoe o arcane_explosion Fluffy_Pillow 44735.1/63371: 71% mana
3:53.778 aoe o arcane_explosion Fluffy_Pillow 41394.2/63371: 65% mana arcane_charge
3:55.084 aoe o arcane_explosion Fluffy_Pillow 38049.4/63371: 60% mana arcane_charge(2), clearcasting
3:56.391 aoe o arcane_explosion Fluffy_Pillow 39706.0/63371: 63% mana arcane_charge(3)
3:57.698 aoe p arcane_barrage Fluffy_Pillow 36362.5/63371: 57% mana arcane_charge(4)
3:59.005 aoe o arcane_explosion Fluffy_Pillow 40553.9/63371: 64% mana
4:00.310 aoe o arcane_explosion Fluffy_Pillow 37207.9/63371: 59% mana arcane_charge
4:01.617 aoe o arcane_explosion Fluffy_Pillow 33864.4/63371: 53% mana arcane_charge(2)
4:02.925 aoe o arcane_explosion Fluffy_Pillow 30522.2/63371: 48% mana arcane_charge(3), clearcasting
4:04.232 aoe p arcane_barrage Fluffy_Pillow 32178.7/63371: 51% mana arcane_charge(4)
4:05.539 aoe j touch_of_the_magi Fluffy_Pillow 36370.1/63371: 57% mana
4:06.847 aoe l rune_of_power Fluffy_Pillow 35527.9/63371: 56% mana arcane_charge(4)
4:08.156 aoe p arcane_barrage Fluffy_Pillow 37187.0/63371: 59% mana arcane_charge(4), rune_of_power
4:09.461 aoe o arcane_explosion Fluffy_Pillow 41375.8/63371: 65% mana rune_of_power
4:10.768 aoe o arcane_explosion Fluffy_Pillow 38032.3/63371: 60% mana arcane_charge, rune_of_power
4:12.072 aoe o arcane_explosion Fluffy_Pillow 34685.1/63371: 55% mana arcane_charge(2), rune_of_power
4:13.377 aoe o arcane_explosion Fluffy_Pillow 31339.1/63371: 49% mana arcane_charge(3), clearcasting, rune_of_power
4:14.685 aoe p arcane_barrage Fluffy_Pillow 32996.9/63371: 52% mana arcane_charge(4), rune_of_power
4:15.992 aoe m arcane_orb Fluffy_Pillow 37188.2/63371: 59% mana rune_of_power
4:17.298 aoe p arcane_barrage Fluffy_Pillow 38343.5/63371: 61% mana arcane_charge(4), rune_of_power
4:18.603 aoe o arcane_explosion Fluffy_Pillow 42532.4/63371: 67% mana rune_of_power
4:19.910 aoe o arcane_explosion Fluffy_Pillow 39188.9/63371: 62% mana arcane_charge, rune_of_power
4:21.217 shared_cds r use_mana_gem NightFae_Koraylon 35845.4/63371: 57% mana arcane_charge(2)
4:21.383 aoe o arcane_explosion Fluffy_Pillow 42393.0/63371: 67% mana arcane_charge(2)
4:22.690 aoe o arcane_explosion Fluffy_Pillow 39049.5/63371: 62% mana arcane_charge(3)
4:23.997 aoe p arcane_barrage Fluffy_Pillow 35706.0/63371: 56% mana arcane_charge(4)
4:25.305 aoe o arcane_explosion Fluffy_Pillow 39898.7/63371: 63% mana
4:26.612 aoe o arcane_explosion Fluffy_Pillow 36555.2/63371: 58% mana arcane_charge
4:27.919 aoe o arcane_explosion Fluffy_Pillow 33211.7/63371: 52% mana arcane_charge(2)
4:29.225 aoe o arcane_explosion Fluffy_Pillow 29867.0/63371: 47% mana arcane_charge(3)
4:30.531 aoe n shifting_power Fluffy_Pillow 26522.2/63371: 42% mana arcane_charge(4), clearcasting
4:34.265 aoe p arcane_barrage Fluffy_Pillow 28754.8/63371: 45% mana arcane_charge(4), clearcasting(2)
4:35.572 aoe m arcane_orb Fluffy_Pillow 32946.2/63371: 52% mana clearcasting(2)
4:36.879 aoe p arcane_barrage Fluffy_Pillow 34102.7/63371: 54% mana arcane_charge(4), clearcasting(2)
4:38.187 aoe o arcane_explosion Fluffy_Pillow 38295.4/63371: 60% mana clearcasting(2)
4:39.495 aoe o arcane_explosion Fluffy_Pillow 39953.2/63371: 63% mana arcane_charge, clearcasting
4:40.801 aoe o arcane_explosion Fluffy_Pillow 41608.5/63371: 66% mana arcane_charge(2)
4:42.109 aoe o arcane_explosion Fluffy_Pillow 38266.3/63371: 60% mana arcane_charge(3)
4:43.413 aoe p arcane_barrage Fluffy_Pillow 34919.0/63371: 55% mana arcane_charge(4)
4:44.720 aoe o arcane_explosion Fluffy_Pillow 39110.4/63371: 62% mana
4:46.028 aoe o arcane_explosion Fluffy_Pillow 35768.2/63371: 56% mana arcane_charge
4:47.334 aoe o arcane_explosion Fluffy_Pillow 32423.4/63371: 51% mana arcane_charge(2)
4:48.641 aoe o arcane_explosion Fluffy_Pillow 29080.0/63371: 46% mana arcane_charge(3), clearcasting
4:49.948 aoe p arcane_barrage Fluffy_Pillow 30736.5/63371: 49% mana arcane_charge(4)
4:51.255 aoe j touch_of_the_magi Fluffy_Pillow 34927.9/63371: 55% mana
4:52.560 aoe k arcane_power Fluffy_Pillow 34081.9/63371: 54% mana arcane_charge(4)
4:52.560 aoe p arcane_barrage Fluffy_Pillow 34081.9/63371: 54% mana arcane_charge(4), arcane_power, rune_of_power
4:53.867 aoe o arcane_explosion Fluffy_Pillow 38273.2/63371: 60% mana arcane_power, rune_of_power
4:55.171 aoe o arcane_explosion Fluffy_Pillow 37426.0/63371: 59% mana arcane_charge, arcane_power, rune_of_power
4:56.478 aoe o arcane_explosion Fluffy_Pillow 36582.5/63371: 58% mana arcane_charge(2), arcane_power, rune_of_power
4:57.786 aoe o arcane_explosion Fluffy_Pillow 35740.3/63371: 56% mana arcane_charge(3), arcane_power, rune_of_power
4:59.090 aoe p arcane_barrage Fluffy_Pillow 34893.0/63371: 55% mana arcane_charge(4), arcane_power, rune_of_power
5:00.397 aoe m arcane_orb Fluffy_Pillow 39084.4/63371: 62% mana arcane_power, rune_of_power
5:01.703 shared_cds s potion Fluffy_Pillow 40489.7/63371: 64% mana arcane_charge(4), arcane_power, rune_of_power
5:01.703 aoe p arcane_barrage Fluffy_Pillow 40489.7/63371: 64% mana arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
5:03.009 aoe o arcane_explosion Fluffy_Pillow 44679.8/63371: 71% mana arcane_power, rune_of_power, potion_of_deathly_fixation
5:04.315 aoe o arcane_explosion Fluffy_Pillow 43835.1/63371: 69% mana arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
5:05.623 aoe o arcane_explosion Fluffy_Pillow 45492.9/63371: 72% mana arcane_charge(2), arcane_power, potion_of_deathly_fixation
5:06.929 aoe o arcane_explosion Fluffy_Pillow 44648.1/63371: 70% mana arcane_charge(3), arcane_power, potion_of_deathly_fixation
5:08.235 aoe l rune_of_power Fluffy_Pillow 43803.4/63371: 69% mana arcane_charge(4), potion_of_deathly_fixation
5:09.542 aoe p arcane_barrage Fluffy_Pillow 45459.9/63371: 72% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:10.849 aoe o arcane_explosion Fluffy_Pillow 49651.3/63371: 78% mana rune_of_power, potion_of_deathly_fixation
5:12.157 aoe o arcane_explosion Fluffy_Pillow 46309.1/63371: 73% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:13.463 aoe o arcane_explosion Fluffy_Pillow 42964.3/63371: 68% mana arcane_charge(2), clearcasting, rune_of_power, potion_of_deathly_fixation
5:14.767 aoe o arcane_explosion Fluffy_Pillow 44617.1/63371: 70% mana arcane_charge(3), rune_of_power, potion_of_deathly_fixation
5:16.073 aoe p arcane_barrage Fluffy_Pillow 41272.3/63371: 65% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.379 aoe o arcane_explosion Fluffy_Pillow 45462.5/63371: 72% mana rune_of_power, potion_of_deathly_fixation
5:18.688 aoe o arcane_explosion Fluffy_Pillow 42121.5/63371: 66% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:19.994 aoe o arcane_explosion Fluffy_Pillow 38776.8/63371: 61% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:21.301 aoe o arcane_explosion Fluffy_Pillow 35433.3/63371: 56% mana arcane_charge(3), rune_of_power, potion_of_deathly_fixation
5:22.609 aoe n shifting_power Fluffy_Pillow 32091.1/63371: 51% mana arcane_charge(4), clearcasting, potion_of_deathly_fixation
5:26.428 aoe p arcane_barrage Fluffy_Pillow 34431.4/63371: 54% mana arcane_charge(4), clearcasting, potion_of_deathly_fixation
5:27.735 aoe m arcane_orb Fluffy_Pillow 38622.8/63371: 61% mana clearcasting
5:29.042 aoe p arcane_barrage Fluffy_Pillow 39779.3/63371: 63% mana arcane_charge(4), clearcasting
5:30.348 aoe o arcane_explosion Fluffy_Pillow 43969.5/63371: 69% mana clearcasting
5:31.652 aoe o arcane_explosion Fluffy_Pillow 45622.2/63371: 72% mana arcane_charge
5:32.960 aoe o arcane_explosion Fluffy_Pillow 42280.0/63371: 67% mana arcane_charge(2)
5:34.267 aoe o arcane_explosion Fluffy_Pillow 38936.5/63371: 61% mana arcane_charge(3)
5:35.573 aoe p arcane_barrage Fluffy_Pillow 35591.8/63371: 56% mana arcane_charge(4)
5:36.879 aoe o arcane_explosion Fluffy_Pillow 39781.9/63371: 63% mana
5:38.186 aoe o arcane_explosion Fluffy_Pillow 36438.4/63371: 57% mana arcane_charge
5:39.493 aoe o arcane_explosion Fluffy_Pillow 33094.9/63371: 52% mana arcane_charge(2)
5:40.801 aoe o arcane_explosion Fluffy_Pillow 29752.7/63371: 47% mana arcane_charge(3)
5:42.107 aoe p arcane_barrage Fluffy_Pillow 26408.0/63371: 42% mana arcane_charge(4)
5:43.414 aoe j touch_of_the_magi Fluffy_Pillow 30599.4/63371: 48% mana
5:44.722 aoe l rune_of_power Fluffy_Pillow 29757.2/63371: 47% mana arcane_charge(4)
5:46.028 aoe p arcane_barrage Fluffy_Pillow 31412.4/63371: 50% mana arcane_charge(4), rune_of_power
5:47.335 aoe o arcane_explosion Fluffy_Pillow 35603.8/63371: 56% mana rune_of_power
5:48.641 aoe o arcane_explosion Fluffy_Pillow 32259.1/63371: 51% mana arcane_charge, rune_of_power
5:49.947 aoe o arcane_explosion Fluffy_Pillow 28914.4/63371: 46% mana arcane_charge(2), rune_of_power
5:51.253 aoe o arcane_explosion Fluffy_Pillow 25569.6/63371: 40% mana arcane_charge(3), rune_of_power
5:52.561 aoe p arcane_barrage Fluffy_Pillow 22227.4/63371: 35% mana arcane_charge(4), rune_of_power
5:53.868 aoe m arcane_orb Fluffy_Pillow 26418.8/63371: 42% mana rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Koraylon"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=325066//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Niya : 11111 dps, 4693 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11111.0 11111.0 13.6 / 0.122% 941.8 / 8.5% 5.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
1894.6 1807.3 Mana 0.00% 48.0 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 11111
Arcane Barrage 3971 35.7% 54.5 5.52sec 21849 17646 Direct 163.2 6119 12229 7298 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.50 163.24 0.00 0.00 1.2382 0.0000 1190738.80 1190738.80 0.00% 17646.06 17646.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 131.79 95 170 6119.29 2082 26275 6118.76 5459 6688 806084 806084 0.00%
crit 19.27% 31.46 14 53 12228.54 4164 52201 12221.65 6724 16914 384655 384655 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.50
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 285 2.6% 41.3 6.94sec 2069 0 Direct 123.8 578 1157 690 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.26 123.77 0.00 0.00 0.0000 0.0000 85363.99 85363.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 99.94 69 133 578.29 443 664 578.26 556 606 57790 57790 0.00%
crit 19.25% 23.83 9 41 1157.33 886 1329 1157.00 1019 1294 27574 27574 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4579 41.2% 142.9 2.07sec 9604 7717 Direct 428.8 2685 5358 3201 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.95 428.84 0.00 0.00 1.2446 0.0000 1372797.37 1372797.37 0.00% 7716.55 7716.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 346.08 260 433 2685.49 1958 4448 2685.82 2588 2779 929446 929446 0.00%
crit 19.30% 82.76 48 118 5357.64 3916 8848 5356.55 4873 5898 443351 443351 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.94
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (886) 0.0% (8.0%) 13.4 22.99sec 19844 16218

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.39 0.00 0.00 0.00 1.2236 0.0000 0.00 0.00 0.00% 16218.07 16218.07

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.38
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 886 8.0% 40.1 22.99sec 6626 0 Direct 40.1 5555 11152 6627 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.09 40.09 0.00 0.00 0.0000 0.0000 265635.74 265635.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 32.43 21 43 5555.00 3869 8743 5556.48 4977 6094 180171 180171 0.00%
crit 19.12% 7.66 0 16 11151.81 7739 17390 11152.06 0 16916 85464 85464 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (0.8%) 18.8 9.52sec 1386 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 0.8% 18.8 9.52sec 1386 0 Direct 18.8 1164 2327 1386 19.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.76 18.76 0.00 0.00 0.0000 0.0000 26002.10 26002.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 15.16 4 29 1163.53 1164 1164 1163.53 1164 1164 17644 17644 0.00%
crit 19.15% 3.59 0 11 2327.06 2327 2327 2237.19 0 2327 8358 8358 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1797 21.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1794.58 1794.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.80% 0.79 0 1 1480.68 1481 1481 1166.78 0 1481 1167 1167 0.00%
crit 21.20% 0.21 0 1 2961.35 2961 2961 627.80 0 2961 628 628 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5787 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.2% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5787.34 5787.34 0.00% 49.14 49.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 72.67 61 84 53.94 43 60 53.94 52 56 3920 3920 0.00%
crit 19.26% 17.33 6 29 107.75 86 120 107.74 93 120 1867 1867 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 394 3.6% 6.1 48.41sec 19528 5467 Periodic 72.2 1372 2745 1638 19.3% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 24.08 72.24 3.5720 0.8348 118293.48 118293.48 0.00% 5467.18 5467.18
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 58.28 41 78 1372.31 1372 1372 1372.31 1372 1372 79975 79975 0.00%
crit 19.33% 13.96 4 26 2744.61 2745 2745 2744.61 2745 2745 38319 38319 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.06
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (886) 0.0% (8.0%) 6.6 48.81sec 39928 30562

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.64 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 30561.52 30561.52

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.67
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 886 8.0% 6.6 48.68sec 39928 0 Direct 19.8 13395 0 13395 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.64 19.80 0.00 0.00 0.0000 0.0000 265060.07 265060.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.80 15 24 13394.68 3446 50182 13419.13 11089 16981 265060 265060 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11694.53
  • base_dd_max:11694.53
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Niya
Arcane Power 3.6 97.13sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.57
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.64sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.0 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.05 0.00 0.29 0.00 4.2852 0.7217 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.05
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.40sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.48
  • if_expr:buff.arcane_power.up
Rune of Power 6.5 47.11sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.48 0.00 0.00 0.00 1.2602 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.51
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.71sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.80
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.2 147.8 5.4sec 1.5sec 4.1sec 75.51% 0.00% 1.9 (2.9) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.8s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.01%
  • arcane_charge_2:15.44%
  • arcane_charge_3:14.51%
  • arcane_charge_4:27.55%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.1sec 97.1sec 14.7sec 17.49% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.0s
  • trigger_min/max:96.0s / 102.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:17.49%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.11% 23.66% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:193.4s / 199.3s
  • trigger_min/max:193.4s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.6 0.2 12.9sec 12.7sec 2.3sec 17.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.66%
  • clearcasting_2:0.37%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.0 0.0 0.0sec 0.0sec 4.3sec 0.07% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:2.8s / 4.3s

Stack Uptimes

  • evocation_1:0.09%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.5 0.0 300.4sec 300.4sec 23.4sec 11.35% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.35%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Redirected Anima 16.7 0.0 52.4sec 16.9sec 67.2sec 84.55% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.5s / 333.0s
  • trigger_min/max:0.3s / 55.0s
  • trigger_pct:98.34%
  • duration_min/max:0.0s / 341.3s

Stack Uptimes

  • redirected_anima_1:16.67%
  • redirected_anima_2:7.36%
  • redirected_anima_3:2.25%
  • redirected_anima_4:0.43%
  • redirected_anima_5:0.09%
  • redirected_anima_6:17.15%
  • redirected_anima_7:23.87%
  • redirected_anima_8:11.80%
  • redirected_anima_9:3.93%
  • redirected_anima_10:0.84%
  • redirected_anima_11:0.15%
  • redirected_anima_12:0.06%
  • redirected_anima_13:0.03%
  • redirected_anima_14:0.02%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.1sec 31.1sec 11.8sec 39.37% 0.00% 0.0 (0.0) 9.6

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.9s
  • trigger_min/max:14.4s / 48.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.37%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.65% 0.76% 8.37% 0.9s 0.0s 3.7s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.091144.122263.871
Evocation244.672171.555340.829297.920183.404359.871
Rune of Power13.4670.33031.39690.50772.265109.382
Touch of the Magi12.2280.00021.59684.07568.088107.102
Arcane Power1.1910.0046.0024.2402.6888.962
Arcane Barrage3.0160.00312.144165.739132.756200.141
Arcane Orb4.2700.00011.58857.91140.38976.216
Shifting Power7.8390.00030.23847.75143.52157.014

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
mana_regen Mana 715.13 383930.49 70.77% 536.87 7446.98 1.90%
Evocation Mana 2.36 2438.66 0.45% 1031.16 0.00 0.00%
Mana Gem Mana 2.80 18104.80 3.34% 6472.37 0.00 0.00%
Arcane Barrage Mana 54.50 138001.41 25.44% 2531.97 4640.72 3.25%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1807.32 1894.59 12109.6 35681.7 82.1 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Niya
arcane_explosion Mana 142.9 530097.3 3708.5 3708.4 2.6
arcane_orb Mana 13.4 5819.1 434.8 434.7 45.6
shifting_power Mana 6.1 15141.9 2500.0 2499.7 7.8
touch_of_the_magi Mana 6.6 16607.9 2500.0 2501.8 16.0

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
NightFae_Niya Damage Per Second
Count 1217
Mean 11111.04
Minimum 10471.58
Maximum 11900.50
Spread ( max - min ) 1428.93
Range [ ( max - min ) / 2 * 100% ] 6.43%
Standard Deviation 241.4163
5th Percentile 10732.67
95th Percentile 11530.58
( 95th Percentile - 5th Percentile ) 797.91
Mean Distribution
Standard Deviation 6.9202
95.00% Confidence Interval ( 11097.48 - 11124.61 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1814
0.1 Scale Factor Error with Delta=300 498
0.05 Scale Factor Error with Delta=300 1991
0.01 Scale Factor Error with Delta=300 49753
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 1217
Mean 4692.73
Minimum 4245.77
Maximum 5315.97
Spread ( max - min ) 1070.20
Range [ ( max - min ) / 2 * 100% ] 11.40%
Standard Deviation 156.4701
5th Percentile 4449.89
95th Percentile 4966.56
( 95th Percentile - 5th Percentile ) 516.67
Mean Distribution
Standard Deviation 4.4852
95.00% Confidence Interval ( 4683.94 - 4701.52 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4271
0.1 Scale Factor Error with Delta=300 210
0.05 Scale Factor Error with Delta=300 837
0.01 Scale Factor Error with Delta=300 20901
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 1217
Mean 11111.04
Minimum 10471.58
Maximum 11900.50
Spread ( max - min ) 1428.93
Range [ ( max - min ) / 2 * 100% ] 6.43%
Damage
NightFae_Niya Damage
Count 1217
Mean 3325686.13
Minimum 2620937.27
Maximum 4093224.84
Spread ( max - min ) 1472287.57
Range [ ( max - min ) / 2 * 100% ] 22.14%
DTPS
NightFae_Niya Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.67 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.57 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.51 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.38 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.06 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.94 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.50 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.05 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.80 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.48 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooropmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpooooproooopjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpoooropoooonpmpoooopoooopjkpoooopmspoooolpoooopoooonpmpoooopoooopjlpoooopm

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Niya 63371.4/63371: 100% mana
Pre precombat R food NightFae_Niya 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4)
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.306 aoe p arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.221 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.134 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.049 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.963 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.877 aoe o arcane_explosion Fluffy_Pillow 61098.7/63800: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:06.791 aoe o arcane_explosion Fluffy_Pillow 59765.0/63800: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:07.707 aoe p arcane_barrage Fluffy_Pillow 58433.8/63800: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:08.622 aoe o arcane_explosion Fluffy_Pillow 62153.3/63800: 97% mana bloodlust, berserking, arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:09.538 aoe o arcane_explosion Fluffy_Pillow 60822.1/63800: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:10.454 aoe o arcane_explosion Fluffy_Pillow 59491.0/63800: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:11.369 aoe o arcane_explosion Fluffy_Pillow 58158.5/63800: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:12.284 aoe p arcane_barrage Fluffy_Pillow 59326.0/63800: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:13.197 aoe o arcane_explosion Fluffy_Pillow 63043.0/63800: 99% mana bloodlust, berserking, arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:14.111 aoe o arcane_explosion Fluffy_Pillow 61709.3/63800: 97% mana bloodlust, arcane_charge, arcane_power, redirected_anima, potion_of_deathly_fixation
0:15.118 aoe o arcane_explosion Fluffy_Pillow 60494.2/63800: 95% mana bloodlust, arcane_charge(2), arcane_power, redirected_anima, potion_of_deathly_fixation
0:16.125 aoe o arcane_explosion Fluffy_Pillow 59677.4/64229: 93% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, redirected_anima(2), potion_of_deathly_fixation
0:17.131 aoe l rune_of_power Fluffy_Pillow 60969.6/64229: 95% mana bloodlust, arcane_charge(4), redirected_anima(2), potion_of_deathly_fixation
0:18.138 aoe p arcane_barrage Fluffy_Pillow 62263.2/64229: 97% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:19.144 aoe o arcane_explosion Fluffy_Pillow 64228.6/64229: 100% mana bloodlust, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:20.152 aoe o arcane_explosion Fluffy_Pillow 60523.4/64229: 94% mana bloodlust, arcane_charge, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:21.159 aoe o arcane_explosion Fluffy_Pillow 56817.0/64229: 88% mana bloodlust, arcane_charge(2), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:22.166 shared_cds r use_mana_gem NightFae_Niya 53110.5/64229: 83% mana bloodlust, arcane_charge(3), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:22.166 aoe o arcane_explosion Fluffy_Pillow 59533.4/64229: 93% mana bloodlust, arcane_charge(3), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:23.172 aoe p arcane_barrage Fluffy_Pillow 55825.7/64229: 87% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:24.178 aoe m arcane_orb Fluffy_Pillow 59687.1/64229: 93% mana bloodlust, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:25.185 aoe p arcane_barrage Fluffy_Pillow 60480.7/64229: 94% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:26.193 aoe o arcane_explosion Fluffy_Pillow 64228.6/64229: 100% mana bloodlust, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:27.199 aoe o arcane_explosion Fluffy_Pillow 60520.9/64229: 94% mana bloodlust, arcane_charge, rune_of_power, redirected_anima(2)
0:28.207 aoe o arcane_explosion Fluffy_Pillow 56815.7/64229: 88% mana bloodlust, arcane_charge(2), rune_of_power, redirected_anima(2)
0:29.212 aoe o arcane_explosion Fluffy_Pillow 53106.7/64229: 83% mana bloodlust, arcane_charge(3), rune_of_power, redirected_anima(2)
0:30.217 aoe n shifting_power Fluffy_Pillow 49397.7/64229: 77% mana bloodlust, arcane_charge(4), clearcasting, redirected_anima(2)
0:33.214 aoe p arcane_barrage Fluffy_Pillow 52779.3/66800: 79% mana bloodlust, arcane_charge(4), clearcasting, redirected_anima(8)
0:34.221 aoe m arcane_orb Fluffy_Pillow 56796.6/66800: 85% mana bloodlust, clearcasting, redirected_anima(8)
0:35.226 aoe p arcane_barrage Fluffy_Pillow 57269.5/66371: 86% mana bloodlust, arcane_charge(4), clearcasting, redirected_anima(7)
0:36.232 aoe o arcane_explosion Fluffy_Pillow 61259.7/66371: 92% mana bloodlust, clearcasting, redirected_anima(7)
0:37.239 aoe o arcane_explosion Fluffy_Pillow 62596.5/66371: 94% mana bloodlust, arcane_charge, redirected_anima(7)
0:38.244 aoe o arcane_explosion Fluffy_Pillow 58930.5/66371: 89% mana bloodlust, arcane_charge(2), redirected_anima(7)
0:39.250 aoe o arcane_explosion Fluffy_Pillow 55265.9/66371: 83% mana bloodlust, arcane_charge(3), redirected_anima(7)
0:40.256 aoe p arcane_barrage Fluffy_Pillow 51601.3/66371: 78% mana bloodlust, arcane_charge(4), redirected_anima(7)
0:41.262 aoe o arcane_explosion Fluffy_Pillow 55591.6/66371: 84% mana redirected_anima(7)
0:42.569 aoe o arcane_explosion Fluffy_Pillow 52326.5/66371: 79% mana arcane_charge, clearcasting, redirected_anima(7)
0:43.876 aoe o arcane_explosion Fluffy_Pillow 54061.5/66371: 81% mana arcane_charge(2), redirected_anima(7)
0:45.182 aoe o arcane_explosion Fluffy_Pillow 50467.1/65943: 77% mana arcane_charge(3), redirected_anima(6)
0:46.488 aoe p arcane_barrage Fluffy_Pillow 47189.5/65943: 72% mana arcane_charge(4), redirected_anima(6)
0:47.792 aoe o arcane_explosion Fluffy_Pillow 51547.0/65943: 78% mana redirected_anima(6)
0:49.098 aoe o arcane_explosion Fluffy_Pillow 48269.4/65943: 73% mana arcane_charge, clearcasting, redirected_anima(6)
0:50.405 aoe j touch_of_the_magi Fluffy_Pillow 49993.2/65943: 76% mana arcane_charge(2), redirected_anima(6)
0:51.711 aoe l rune_of_power Fluffy_Pillow 49215.6/65943: 75% mana arcane_charge(4), redirected_anima(6)
0:53.017 aoe p arcane_barrage Fluffy_Pillow 50938.0/65943: 77% mana arcane_charge(4), rune_of_power, redirected_anima(6)
0:54.325 aoe m arcane_orb Fluffy_Pillow 55300.8/65943: 84% mana rune_of_power, redirected_anima(6)
0:55.632 aoe p arcane_barrage Fluffy_Pillow 56524.6/65943: 86% mana arcane_charge(4), rune_of_power, redirected_anima(6)
0:56.939 aoe o arcane_explosion Fluffy_Pillow 60886.0/65943: 92% mana rune_of_power, redirected_anima(6)
0:58.245 aoe o arcane_explosion Fluffy_Pillow 57608.5/65943: 87% mana arcane_charge, rune_of_power, redirected_anima(6)
0:59.552 aoe o arcane_explosion Fluffy_Pillow 54332.2/65943: 82% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(6)
1:00.858 aoe o arcane_explosion Fluffy_Pillow 53868.8/63371: 85% mana arcane_charge(3), rune_of_power
1:02.166 aoe p arcane_barrage Fluffy_Pillow 50526.6/63371: 80% mana arcane_charge(4), rune_of_power
1:03.474 aoe o arcane_explosion Fluffy_Pillow 55089.3/63800: 86% mana rune_of_power, redirected_anima
1:04.781 aoe o arcane_explosion Fluffy_Pillow 51757.0/63800: 81% mana arcane_charge, clearcasting, rune_of_power, redirected_anima
1:06.088 aoe o arcane_explosion Fluffy_Pillow 53424.8/63800: 84% mana arcane_charge(2), redirected_anima
1:07.395 aoe o arcane_explosion Fluffy_Pillow 50092.5/63800: 79% mana arcane_charge(3), redirected_anima
1:08.702 aoe p arcane_barrage Fluffy_Pillow 46760.2/63800: 73% mana arcane_charge(4), redirected_anima
1:10.008 aoe o arcane_explosion Fluffy_Pillow 50978.7/63800: 80% mana redirected_anima
1:11.313 aoe o arcane_explosion Fluffy_Pillow 47643.9/63800: 75% mana arcane_charge, redirected_anima
1:12.621 aoe o arcane_explosion Fluffy_Pillow 44312.9/63800: 69% mana arcane_charge(2), clearcasting, redirected_anima
1:13.928 aoe o arcane_explosion Fluffy_Pillow 45980.6/63800: 72% mana arcane_charge(3), redirected_anima
1:15.235 aoe n shifting_power Fluffy_Pillow 42648.3/63800: 67% mana arcane_charge(4), redirected_anima
1:18.903 aoe p arcane_barrage Fluffy_Pillow 46635.5/66371: 70% mana arcane_charge(4), redirected_anima(7)
1:20.209 aoe m arcane_orb Fluffy_Pillow 51024.0/66371: 77% mana redirected_anima(7)
1:21.514 aoe p arcane_barrage Fluffy_Pillow 52256.3/66371: 79% mana arcane_charge(4), redirected_anima(7)
1:22.821 aoe o arcane_explosion Fluffy_Pillow 57011.9/66800: 85% mana redirected_anima(8)
1:24.127 aoe o arcane_explosion Fluffy_Pillow 53756.7/66800: 80% mana arcane_charge, clearcasting, redirected_anima(8)
1:25.434 aoe o arcane_explosion Fluffy_Pillow 55502.8/66800: 83% mana arcane_charge(2), redirected_anima(8)
1:26.742 aoe o arcane_explosion Fluffy_Pillow 52250.3/66800: 78% mana arcane_charge(3), clearcasting, redirected_anima(8)
1:28.048 aoe p arcane_barrage Fluffy_Pillow 53995.1/66800: 81% mana arcane_charge(4), redirected_anima(8)
1:29.355 aoe o arcane_explosion Fluffy_Pillow 58413.3/66800: 87% mana redirected_anima(8)
1:30.662 aoe o arcane_explosion Fluffy_Pillow 55159.4/66800: 83% mana arcane_charge, redirected_anima(8)
1:31.969 aoe o arcane_explosion Fluffy_Pillow 51905.6/66800: 78% mana arcane_charge(2), redirected_anima(8)
1:33.276 aoe o arcane_explosion Fluffy_Pillow 48339.6/66371: 73% mana arcane_charge(3), clearcasting, redirected_anima(7)
1:34.583 aoe p arcane_barrage Fluffy_Pillow 50074.6/66371: 75% mana arcane_charge(4), redirected_anima(7)
1:35.891 aoe o arcane_explosion Fluffy_Pillow 54465.7/66371: 82% mana redirected_anima(7)
1:37.198 aoe j touch_of_the_magi Fluffy_Pillow 51200.6/66371: 77% mana arcane_charge, redirected_anima(7)
1:38.504 aoe k arcane_power Fluffy_Pillow 50434.3/66371: 76% mana arcane_charge(4), redirected_anima(7)
1:38.504 aoe p arcane_barrage Fluffy_Pillow 50434.3/66371: 76% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(7)
1:39.811 aoe o arcane_explosion Fluffy_Pillow 54824.1/66371: 83% mana arcane_power, rune_of_power, redirected_anima(7)
1:41.116 aoe o arcane_explosion Fluffy_Pillow 54056.4/66371: 81% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(7)
1:42.424 aoe o arcane_explosion Fluffy_Pillow 53292.6/66371: 80% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(7)
1:43.730 aoe o arcane_explosion Fluffy_Pillow 52865.4/66800: 79% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(8)
1:45.035 aoe p arcane_barrage Fluffy_Pillow 52108.9/66800: 78% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8)
1:46.340 aoe m arcane_orb Fluffy_Pillow 54348.5/64229: 85% mana arcane_power, rune_of_power, redirected_anima(2)
1:47.646 aoe p arcane_barrage Fluffy_Pillow 55776.2/64229: 87% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(2)
1:48.952 aoe o arcane_explosion Fluffy_Pillow 60023.0/64229: 93% mana arcane_power, rune_of_power, redirected_anima(2)
1:50.257 aoe o arcane_explosion Fluffy_Pillow 59199.3/64229: 92% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(2)
1:51.563 aoe o arcane_explosion Fluffy_Pillow 57987.4/63800: 91% mana arcane_charge(2), arcane_power, redirected_anima
1:52.869 aoe o arcane_explosion Fluffy_Pillow 57153.9/63800: 90% mana arcane_charge(3), arcane_power, redirected_anima
1:54.176 aoe l rune_of_power Fluffy_Pillow 56321.6/63800: 88% mana arcane_charge(4), redirected_anima
1:55.482 aoe p arcane_barrage Fluffy_Pillow 57988.1/63800: 91% mana arcane_charge(4), rune_of_power, redirected_anima
1:56.786 aoe o arcane_explosion Fluffy_Pillow 62204.0/63800: 97% mana rune_of_power, redirected_anima
1:58.094 aoe o arcane_explosion Fluffy_Pillow 58873.0/63800: 92% mana arcane_charge, rune_of_power, redirected_anima
1:59.398 aoe o arcane_explosion Fluffy_Pillow 55536.9/63800: 87% mana arcane_charge(2), rune_of_power, redirected_anima
2:00.704 aoe o arcane_explosion Fluffy_Pillow 52203.4/63800: 82% mana arcane_charge(3), rune_of_power, redirected_anima
2:02.011 aoe p arcane_barrage Fluffy_Pillow 48871.1/63800: 77% mana arcane_charge(4), rune_of_power, redirected_anima
2:03.318 aoe o arcane_explosion Fluffy_Pillow 53090.8/63800: 83% mana rune_of_power, redirected_anima
2:04.624 aoe o arcane_explosion Fluffy_Pillow 49757.3/63800: 78% mana arcane_charge, rune_of_power, redirected_anima
2:05.930 aoe o arcane_explosion Fluffy_Pillow 46423.7/63800: 73% mana arcane_charge(2), rune_of_power, redirected_anima
2:07.239 aoe o arcane_explosion Fluffy_Pillow 43094.0/63800: 68% mana arcane_charge(3), rune_of_power, redirected_anima
2:08.546 aoe n shifting_power Fluffy_Pillow 39761.8/63800: 62% mana arcane_charge(4), clearcasting, redirected_anima
2:12.297 aoe p arcane_barrage Fluffy_Pillow 43742.8/66371: 66% mana arcane_charge(4), clearcasting, redirected_anima(7)
2:13.601 aoe m arcane_orb Fluffy_Pillow 47817.8/65943: 73% mana clearcasting, redirected_anima(6)
2:14.906 aoe p arcane_barrage Fluffy_Pillow 49038.9/65943: 74% mana arcane_charge(4), clearcasting, redirected_anima(6)
2:16.212 aoe o arcane_explosion Fluffy_Pillow 53399.1/65943: 81% mana clearcasting, redirected_anima(6)
2:17.520 aoe o arcane_explosion Fluffy_Pillow 55124.1/65943: 84% mana arcane_charge, redirected_anima(6)
2:18.825 aoe o arcane_explosion Fluffy_Pillow 51845.2/65943: 79% mana arcane_charge(2), clearcasting, redirected_anima(6)
2:20.133 aoe o arcane_explosion Fluffy_Pillow 53570.3/65943: 81% mana arcane_charge(3), redirected_anima(6)
2:21.440 aoe p arcane_barrage Fluffy_Pillow 50294.0/65943: 76% mana arcane_charge(4), redirected_anima(6)
2:22.747 shared_cds r use_mana_gem NightFae_Niya 54655.5/65943: 83% mana redirected_anima(6)
2:22.747 aoe o arcane_explosion Fluffy_Pillow 61249.8/65943: 93% mana redirected_anima(6)
2:24.054 aoe o arcane_explosion Fluffy_Pillow 57973.5/65943: 88% mana arcane_charge, clearcasting, redirected_anima(6)
2:25.360 aoe o arcane_explosion Fluffy_Pillow 59696.0/65943: 91% mana arcane_charge(2), redirected_anima(6)
2:26.667 aoe o arcane_explosion Fluffy_Pillow 56419.7/65943: 86% mana arcane_charge(3), redirected_anima(6)
2:27.973 aoe p arcane_barrage Fluffy_Pillow 53142.1/65943: 81% mana arcane_charge(4), redirected_anima(6)
2:29.278 aoe j touch_of_the_magi Fluffy_Pillow 57501.0/65943: 87% mana redirected_anima(6)
2:30.583 aoe l rune_of_power Fluffy_Pillow 56722.1/65943: 86% mana arcane_charge(4), redirected_anima(6)
2:31.888 aoe p arcane_barrage Fluffy_Pillow 58443.2/65943: 89% mana arcane_charge(4), rune_of_power, redirected_anima(6)
2:33.195 aoe o arcane_explosion Fluffy_Pillow 62804.6/65943: 95% mana rune_of_power, redirected_anima(6)
2:34.502 aoe o arcane_explosion Fluffy_Pillow 59528.4/65943: 90% mana arcane_charge, rune_of_power, redirected_anima(6)
2:35.808 aoe o arcane_explosion Fluffy_Pillow 56250.8/65943: 85% mana arcane_charge(2), rune_of_power, redirected_anima(6)
2:37.115 aoe o arcane_explosion Fluffy_Pillow 53318.8/66371: 80% mana arcane_charge(3), rune_of_power, redirected_anima(7)
2:38.423 aoe p arcane_barrage Fluffy_Pillow 50055.1/66371: 75% mana arcane_charge(4), rune_of_power, redirected_anima(7)
2:39.728 aoe m arcane_orb Fluffy_Pillow 52333.0/63800: 82% mana rune_of_power, redirected_anima
2:41.035 aoe p arcane_barrage Fluffy_Pillow 53500.7/63800: 84% mana arcane_charge(4), rune_of_power, redirected_anima
2:42.344 aoe o arcane_explosion Fluffy_Pillow 57723.0/63800: 90% mana rune_of_power, redirected_anima
2:43.650 aoe o arcane_explosion Fluffy_Pillow 54389.5/63800: 85% mana arcane_charge, clearcasting, rune_of_power, redirected_anima
2:44.957 aoe o arcane_explosion Fluffy_Pillow 56057.2/63800: 88% mana arcane_charge(2), redirected_anima
2:46.263 aoe o arcane_explosion Fluffy_Pillow 52723.7/63800: 83% mana arcane_charge(3), clearcasting, redirected_anima
2:47.569 aoe p arcane_barrage Fluffy_Pillow 54390.1/63800: 85% mana arcane_charge(4), redirected_anima
2:48.876 aoe o arcane_explosion Fluffy_Pillow 58609.9/63800: 92% mana redirected_anima
2:50.183 aoe o arcane_explosion Fluffy_Pillow 55277.6/63800: 87% mana arcane_charge, redirected_anima
2:51.492 aoe o arcane_explosion Fluffy_Pillow 51947.9/63800: 81% mana arcane_charge(2), redirected_anima
2:52.800 aoe o arcane_explosion Fluffy_Pillow 48616.9/63800: 76% mana arcane_charge(3), redirected_anima
2:54.104 aoe n shifting_power Fluffy_Pillow 45280.8/63800: 71% mana arcane_charge(4), redirected_anima
2:57.837 aoe p arcane_barrage Fluffy_Pillow 49460.3/66371: 75% mana arcane_charge(4), redirected_anima(7)
2:59.142 aoe m arcane_orb Fluffy_Pillow 53847.5/66371: 81% mana redirected_anima(7)
3:00.450 aoe p arcane_barrage Fluffy_Pillow 55083.8/66371: 83% mana arcane_charge(4), redirected_anima(7)
3:01.757 aoe o arcane_explosion Fluffy_Pillow 59473.6/66371: 90% mana redirected_anima(7)
3:03.065 aoe o arcane_explosion Fluffy_Pillow 56209.9/66371: 85% mana arcane_charge, redirected_anima(7)
3:04.372 aoe o arcane_explosion Fluffy_Pillow 52944.8/66371: 80% mana arcane_charge(2), clearcasting, redirected_anima(7)
3:05.677 aoe o arcane_explosion Fluffy_Pillow 54677.1/66371: 82% mana arcane_charge(3), redirected_anima(7)
3:06.984 aoe p arcane_barrage Fluffy_Pillow 51080.1/65943: 77% mana arcane_charge(4), redirected_anima(6)
3:08.290 aoe o arcane_explosion Fluffy_Pillow 55440.2/65943: 84% mana redirected_anima(6)
3:09.595 aoe o arcane_explosion Fluffy_Pillow 52161.3/65943: 79% mana arcane_charge, redirected_anima(6)
3:10.902 aoe o arcane_explosion Fluffy_Pillow 48885.1/65943: 74% mana arcane_charge(2), redirected_anima(6)
3:12.209 aoe o arcane_explosion Fluffy_Pillow 45608.8/65943: 69% mana arcane_charge(3), redirected_anima(6)
3:13.516 aoe p arcane_barrage Fluffy_Pillow 42332.6/65943: 64% mana arcane_charge(4), redirected_anima(6)
3:14.821 aoe j touch_of_the_magi Fluffy_Pillow 46691.4/65943: 71% mana redirected_anima(6)
3:16.128 aoe k arcane_power Fluffy_Pillow 45915.1/65943: 70% mana arcane_charge(4), redirected_anima(6)
3:16.128 shared_cds t berserking Fluffy_Pillow 45915.1/65943: 70% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
3:16.128 aoe p arcane_barrage Fluffy_Pillow 45915.1/65943: 70% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
3:17.316 aoe o arcane_explosion Fluffy_Pillow 50119.6/65943: 76% mana berserking, arcane_power, rune_of_power, redirected_anima(6)
3:18.504 aoe o arcane_explosion Fluffy_Pillow 49186.4/65943: 75% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, redirected_anima(6)
3:19.690 aoe o arcane_explosion Fluffy_Pillow 50750.6/65943: 77% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(6)
3:20.877 aoe o arcane_explosion Fluffy_Pillow 49816.1/65943: 76% mana berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima(6)
3:22.065 aoe p arcane_barrage Fluffy_Pillow 48882.9/65943: 74% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
3:23.254 aoe m arcane_orb Fluffy_Pillow 53088.7/65943: 81% mana berserking, arcane_power, rune_of_power, redirected_anima(6)
3:24.444 aoe p arcane_barrage Fluffy_Pillow 52286.5/63371: 83% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:25.632 aoe o arcane_explosion Fluffy_Pillow 56327.1/63371: 89% mana berserking, arcane_power, rune_of_power
3:26.821 aoe o arcane_explosion Fluffy_Pillow 55334.1/63371: 87% mana berserking, arcane_charge, arcane_power, rune_of_power
3:28.009 aoe o arcane_explosion Fluffy_Pillow 54339.8/63371: 86% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:29.198 aoe o arcane_explosion Fluffy_Pillow 53346.7/63371: 84% mana arcane_charge(3), arcane_power
3:30.505 aoe l rune_of_power Fluffy_Pillow 52503.3/63371: 83% mana arcane_charge(4), arcane_power
3:31.813 aoe p arcane_barrage Fluffy_Pillow 54161.1/63371: 85% mana arcane_charge(4), rune_of_power
3:33.120 aoe o arcane_explosion Fluffy_Pillow 58352.5/63371: 92% mana rune_of_power
3:34.426 aoe o arcane_explosion Fluffy_Pillow 55007.7/63371: 87% mana arcane_charge, rune_of_power
3:35.733 aoe o arcane_explosion Fluffy_Pillow 51664.3/63371: 82% mana arcane_charge(2), rune_of_power
3:37.038 aoe o arcane_explosion Fluffy_Pillow 48318.2/63371: 76% mana arcane_charge(3), rune_of_power
3:38.346 aoe p arcane_barrage Fluffy_Pillow 44976.0/63371: 71% mana arcane_charge(4), clearcasting, rune_of_power
3:39.653 aoe o arcane_explosion Fluffy_Pillow 49167.4/63371: 78% mana clearcasting, rune_of_power
3:40.958 aoe o arcane_explosion Fluffy_Pillow 50821.4/63371: 80% mana arcane_charge, rune_of_power
3:42.266 aoe o arcane_explosion Fluffy_Pillow 47800.3/63800: 75% mana arcane_charge(2), rune_of_power, redirected_anima
3:43.572 aoe o arcane_explosion Fluffy_Pillow 44466.8/63800: 70% mana arcane_charge(3), rune_of_power, redirected_anima
3:44.878 aoe n shifting_power Fluffy_Pillow 41133.2/63800: 64% mana arcane_charge(4), redirected_anima
3:48.530 aoe p arcane_barrage Fluffy_Pillow 45328.9/66800: 68% mana arcane_charge(4), redirected_anima(8)
3:49.838 aoe m arcane_orb Fluffy_Pillow 49748.4/66800: 74% mana redirected_anima(8)
3:51.146 aoe p arcane_barrage Fluffy_Pillow 50995.9/66800: 76% mana arcane_charge(4), redirected_anima(8)
3:52.454 aoe o arcane_explosion Fluffy_Pillow 55415.4/66800: 83% mana redirected_anima(8)
3:53.761 aoe o arcane_explosion Fluffy_Pillow 52161.5/66800: 78% mana arcane_charge, redirected_anima(8)
3:55.068 aoe o arcane_explosion Fluffy_Pillow 48907.7/66800: 73% mana arcane_charge(2), redirected_anima(8)
3:56.374 aoe o arcane_explosion Fluffy_Pillow 45652.5/66800: 68% mana arcane_charge(3), redirected_anima(8)
3:57.683 aoe p arcane_barrage Fluffy_Pillow 42401.3/66800: 63% mana arcane_charge(4), redirected_anima(8)
3:58.989 aoe o arcane_explosion Fluffy_Pillow 47118.5/67229: 70% mana redirected_anima(9)
4:00.297 aoe o arcane_explosion Fluffy_Pillow 43877.2/67229: 65% mana arcane_charge, redirected_anima(9)
4:01.604 aoe o arcane_explosion Fluffy_Pillow 40634.6/67229: 60% mana arcane_charge(2), redirected_anima(9)
4:02.909 aoe o arcane_explosion Fluffy_Pillow 37389.2/67229: 56% mana arcane_charge(3), redirected_anima(9)
4:04.217 aoe p arcane_barrage Fluffy_Pillow 34147.9/67229: 51% mana arcane_charge(4), redirected_anima(9)
4:05.522 aoe j touch_of_the_magi Fluffy_Pillow 38591.7/67229: 57% mana redirected_anima(9)
4:06.829 aoe l rune_of_power Fluffy_Pillow 37849.1/67229: 56% mana arcane_charge(4), redirected_anima(9)
4:08.136 aoe p arcane_barrage Fluffy_Pillow 39606.4/67229: 59% mana arcane_charge(4), rune_of_power, redirected_anima(9)
4:09.441 aoe o arcane_explosion Fluffy_Pillow 44050.3/67229: 66% mana rune_of_power, redirected_anima(9)
4:10.748 aoe o arcane_explosion Fluffy_Pillow 40807.6/67229: 61% mana arcane_charge, rune_of_power, redirected_anima(9)
4:12.056 aoe o arcane_explosion Fluffy_Pillow 37326.8/66800: 56% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(8)
4:13.363 aoe o arcane_explosion Fluffy_Pillow 39073.0/66800: 58% mana arcane_charge(3), rune_of_power, redirected_anima(8)
4:14.670 aoe p arcane_barrage Fluffy_Pillow 35819.1/66800: 54% mana arcane_charge(4), rune_of_power, redirected_anima(8)
4:15.976 aoe m arcane_orb Fluffy_Pillow 38687.1/64229: 60% mana rune_of_power, redirected_anima(2)
4:17.283 aoe p arcane_barrage Fluffy_Pillow 39600.0/63800: 62% mana arcane_charge(4), rune_of_power, redirected_anima
4:18.589 aoe o arcane_explosion Fluffy_Pillow 43818.5/63800: 69% mana rune_of_power, redirected_anima
4:19.897 aoe o arcane_explosion Fluffy_Pillow 40487.5/63800: 63% mana arcane_charge, rune_of_power, redirected_anima
4:21.205 aoe o arcane_explosion Fluffy_Pillow 37156.5/63800: 58% mana arcane_charge(2), redirected_anima
4:22.513 shared_cds r use_mana_gem NightFae_Niya 33825.5/63800: 53% mana arcane_charge(3), redirected_anima
4:22.747 aoe o arcane_explosion Fluffy_Pillow 40504.1/63800: 63% mana arcane_charge(3), redirected_anima
4:24.052 aoe p arcane_barrage Fluffy_Pillow 37169.3/63800: 58% mana arcane_charge(4), redirected_anima
4:25.360 aoe o arcane_explosion Fluffy_Pillow 41390.3/63800: 65% mana redirected_anima
4:26.667 aoe o arcane_explosion Fluffy_Pillow 38058.0/63800: 60% mana arcane_charge, clearcasting, redirected_anima
4:27.973 aoe o arcane_explosion Fluffy_Pillow 39457.6/63371: 62% mana arcane_charge(2)
4:29.280 aoe o arcane_explosion Fluffy_Pillow 36114.1/63371: 57% mana arcane_charge(3), clearcasting
4:30.587 aoe n shifting_power Fluffy_Pillow 37770.7/63371: 60% mana arcane_charge(4)
4:34.344 aoe p arcane_barrage Fluffy_Pillow 41656.8/65943: 63% mana arcane_charge(4), redirected_anima(6)
4:35.651 aoe m arcane_orb Fluffy_Pillow 46018.3/65943: 70% mana redirected_anima(6)
4:36.958 aoe p arcane_barrage Fluffy_Pillow 47242.0/65943: 72% mana arcane_charge(4), redirected_anima(6)
4:38.265 aoe o arcane_explosion Fluffy_Pillow 51603.5/65943: 78% mana redirected_anima(6)
4:39.571 aoe o arcane_explosion Fluffy_Pillow 48325.9/65943: 73% mana arcane_charge, redirected_anima(6)
4:40.877 aoe o arcane_explosion Fluffy_Pillow 45048.3/65943: 68% mana arcane_charge(2), redirected_anima(6)
4:42.183 aoe o arcane_explosion Fluffy_Pillow 41770.7/65943: 63% mana arcane_charge(3), redirected_anima(6)
4:43.490 aoe p arcane_barrage Fluffy_Pillow 38494.5/65943: 58% mana arcane_charge(4), redirected_anima(6)
4:44.799 aoe o arcane_explosion Fluffy_Pillow 42858.6/65943: 65% mana redirected_anima(6)
4:46.104 aoe o arcane_explosion Fluffy_Pillow 39579.7/65943: 60% mana arcane_charge, redirected_anima(6)
4:47.411 aoe o arcane_explosion Fluffy_Pillow 36303.4/65943: 55% mana arcane_charge(2), redirected_anima(6)
4:48.718 aoe o arcane_explosion Fluffy_Pillow 33027.2/65943: 50% mana arcane_charge(3), redirected_anima(6)
4:50.025 aoe p arcane_barrage Fluffy_Pillow 29750.9/65943: 45% mana arcane_charge(4), redirected_anima(6)
4:51.332 aoe j touch_of_the_magi Fluffy_Pillow 34112.4/65943: 52% mana redirected_anima(6)
4:52.639 aoe k arcane_power Fluffy_Pillow 33336.1/65943: 51% mana arcane_charge(4), redirected_anima(6)
4:52.639 aoe p arcane_barrage Fluffy_Pillow 33336.1/65943: 51% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
4:53.946 aoe o arcane_explosion Fluffy_Pillow 37942.6/66371: 57% mana arcane_power, rune_of_power, redirected_anima(7)
4:55.252 aoe o arcane_explosion Fluffy_Pillow 37176.2/66371: 56% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(7)
4:56.558 aoe o arcane_explosion Fluffy_Pillow 36409.8/66371: 55% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, redirected_anima(7)
4:57.865 aoe o arcane_explosion Fluffy_Pillow 38144.8/66371: 57% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(7)
4:59.170 aoe p arcane_barrage Fluffy_Pillow 37377.1/66371: 56% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(7)
5:00.475 aoe m arcane_orb Fluffy_Pillow 41764.2/66371: 63% mana arcane_power, rune_of_power, redirected_anima(7)
5:01.782 shared_cds s potion Fluffy_Pillow 41573.6/63800: 65% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima
5:01.782 aoe p arcane_barrage Fluffy_Pillow 41573.6/63800: 65% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
5:03.090 aoe o arcane_explosion Fluffy_Pillow 45794.6/63800: 72% mana arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
5:04.395 aoe o arcane_explosion Fluffy_Pillow 45261.8/64229: 70% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:05.702 aoe o arcane_explosion Fluffy_Pillow 44440.7/64229: 69% mana arcane_charge(2), arcane_power, redirected_anima(2), potion_of_deathly_fixation
5:07.009 aoe o arcane_explosion Fluffy_Pillow 43619.7/64229: 68% mana arcane_charge(3), arcane_power, redirected_anima(2), potion_of_deathly_fixation
5:08.317 aoe l rune_of_power Fluffy_Pillow 42799.9/64229: 67% mana arcane_charge(4), redirected_anima(2), potion_of_deathly_fixation
5:09.623 aoe p arcane_barrage Fluffy_Pillow 44477.5/64229: 69% mana arcane_charge(4), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:10.930 aoe o arcane_explosion Fluffy_Pillow 48725.6/64229: 76% mana rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:12.236 aoe o arcane_explosion Fluffy_Pillow 45403.3/64229: 71% mana arcane_charge, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:13.543 aoe o arcane_explosion Fluffy_Pillow 42082.2/64229: 66% mana arcane_charge(2), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:14.849 aoe o arcane_explosion Fluffy_Pillow 38759.8/64229: 60% mana arcane_charge(3), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:16.155 aoe p arcane_barrage Fluffy_Pillow 35437.5/64229: 55% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:17.463 aoe o arcane_explosion Fluffy_Pillow 39951.7/64657: 62% mana clearcasting, rune_of_power, redirected_anima(3), potion_of_deathly_fixation
5:18.769 aoe o arcane_explosion Fluffy_Pillow 41640.5/64657: 64% mana arcane_charge, rune_of_power, redirected_anima(3), potion_of_deathly_fixation
5:20.076 aoe o arcane_explosion Fluffy_Pillow 38330.6/64657: 59% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(3), potion_of_deathly_fixation
5:21.382 aoe o arcane_explosion Fluffy_Pillow 40019.5/64657: 62% mana arcane_charge(3), rune_of_power, redirected_anima(3), potion_of_deathly_fixation
5:22.689 aoe n shifting_power Fluffy_Pillow 36466.3/64229: 57% mana arcane_charge(4), redirected_anima(2), potion_of_deathly_fixation
5:26.395 aoe p arcane_barrage Fluffy_Pillow 40794.2/67657: 60% mana arcane_charge(4), redirected_anima(10), potion_of_deathly_fixation
5:27.701 aoe m arcane_orb Fluffy_Pillow 45267.7/67657: 67% mana redirected_anima(10)
5:29.008 aoe p arcane_barrage Fluffy_Pillow 46536.3/67657: 69% mana arcane_charge(4), redirected_anima(10)
5:30.314 aoe o arcane_explosion Fluffy_Pillow 51009.7/67657: 75% mana redirected_anima(10)
5:31.621 aoe o arcane_explosion Fluffy_Pillow 47778.3/67657: 71% mana arcane_charge, redirected_anima(10)
5:32.927 aoe o arcane_explosion Fluffy_Pillow 44545.5/67657: 66% mana arcane_charge(2), redirected_anima(10)
5:34.234 aoe o arcane_explosion Fluffy_Pillow 41052.4/67229: 61% mana arcane_charge(3), redirected_anima(9)
5:35.542 aoe p arcane_barrage Fluffy_Pillow 37811.1/67229: 56% mana arcane_charge(4), clearcasting, redirected_anima(9)
5:36.849 aoe o arcane_explosion Fluffy_Pillow 42257.6/67229: 63% mana clearcasting, redirected_anima(9)
5:38.156 aoe o arcane_explosion Fluffy_Pillow 44014.9/67229: 65% mana arcane_charge, redirected_anima(9)
5:39.461 aoe o arcane_explosion Fluffy_Pillow 40769.6/67229: 61% mana arcane_charge(2), redirected_anima(9)
5:40.767 aoe o arcane_explosion Fluffy_Pillow 37525.6/67229: 56% mana arcane_charge(3), redirected_anima(9)
5:42.073 aoe p arcane_barrage Fluffy_Pillow 34500.1/67657: 51% mana arcane_charge(4), redirected_anima(10)
5:43.381 aoe j touch_of_the_magi Fluffy_Pillow 38976.3/67657: 58% mana redirected_anima(10)
5:44.688 aoe l rune_of_power Fluffy_Pillow 38244.9/67657: 57% mana arcane_charge(4), redirected_anima(10)
5:45.995 aoe p arcane_barrage Fluffy_Pillow 40013.4/67657: 59% mana arcane_charge(4), rune_of_power, redirected_anima(10)
5:47.302 aoe o arcane_explosion Fluffy_Pillow 44206.5/67229: 66% mana rune_of_power, redirected_anima(9)
5:48.609 aoe o arcane_explosion Fluffy_Pillow 40963.8/67229: 61% mana arcane_charge, clearcasting, rune_of_power, redirected_anima(9)
5:49.916 aoe o arcane_explosion Fluffy_Pillow 42721.2/67229: 64% mana arcane_charge(2), rune_of_power, redirected_anima(9)
5:51.223 aoe o arcane_explosion Fluffy_Pillow 39478.5/67229: 59% mana arcane_charge(3), clearcasting, rune_of_power, redirected_anima(9)
5:52.530 aoe p arcane_barrage Fluffy_Pillow 41235.9/67229: 61% mana arcane_charge(4), rune_of_power, redirected_anima(9)
5:53.837 aoe m arcane_orb Fluffy_Pillow 43935.1/64657: 68% mana rune_of_power, redirected_anima(3)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Niya"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=322721//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Nadjia : 10715 dps, 4639 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10715.0 10715.0 16.7 / 0.156% 1148.9 / 10.7% 5.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
2087.6 1986.3 Mana 0.00% 50.4 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 10715
Arcane Barrage 3943 36.8% 57.7 5.20sec 20515 16788 Direct 172.8 5737 11496 6849 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.68 172.79 0.00 0.00 1.2220 0.0000 1183270.61 1183270.61 0.00% 16788.03 16788.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 139.40 102 181 5736.65 2082 25140 5733.00 4983 6351 799609 799609 0.00%
crit 19.32% 33.39 15 56 11495.74 4164 50280 11505.33 7825 17062 383662 383662 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.67
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 278 2.6% 43.7 6.44sec 1909 0 Direct 131.1 533 1067 636 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.68 131.05 0.00 0.00 0.0000 0.0000 83372.66 83372.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 105.81 71 135 533.50 316 664 532.72 495 560 56434 56434 0.00%
crit 19.26% 25.25 10 43 1067.19 633 1329 1065.95 915 1218 26938 26938 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4640 43.3% 156.7 1.88sec 8881 7292 Direct 470.1 2483 4964 2960 19.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 156.70 470.09 0.00 0.00 1.2179 0.0000 1391571.72 1391571.72 0.00% 7292.05 7292.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 379.63 286 469 2483.27 1958 4112 2483.36 2363 2582 942654 942654 0.00%
crit 19.24% 90.46 54 135 4964.04 3916 8223 4963.76 4469 5406 448917 448917 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:156.71
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (821) 0.0% (7.7%) 13.2 23.44sec 18683 15178

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.18 0.00 0.00 0.00 1.2310 0.0000 0.00 0.00 0.00% 15177.59 15177.59

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.17
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 821 7.7% 39.4 23.44sec 6241 0 Direct 39.4 5231 10458 6242 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.45 39.45 0.00 0.00 0.0000 0.0000 246180.48 246180.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 31.82 20 44 5231.14 3869 8126 5234.67 4543 5869 166438 166438 0.00%
crit 19.33% 7.62 1 16 10457.85 7739 16251 10454.30 7739 16251 79742 79742 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.6%) 14.8 1.75sec 1392 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.6% 14.8 1.75sec 1392 0 Direct 14.8 1164 2327 1392 19.7%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.76 14.76 0.00 0.00 0.0000 0.0000 20554.44 20554.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.33% 11.86 4 20 1163.53 1164 1164 1163.53 1164 1164 13797 13797 0.00%
crit 19.67% 2.90 0 8 2327.06 2327 2327 2214.25 0 2327 6757 6757 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1776 20.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1776.33 1776.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.03% 0.80 0 1 1480.68 1481 1481 1185.03 0 1481 1185 1185 0.00%
crit 19.97% 0.20 0 1 2961.35 2961 2961 591.30 0 2961 591 591 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5793 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.2% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5792.85 5792.85 0.00% 49.18 49.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 72.59 61 83 53.93 43 60 53.93 53 56 3915 3915 0.00%
crit 19.35% 17.41 7 29 107.85 86 120 107.83 92 120 1878 1878 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (139) 0.0% (1.3%) 2.9 130.07sec 14603 11870

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 1.2304 0.0000 0.00 0.00 0.00% 11869.54 11869.54

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.87
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 69 0.6% 5.7 52.78sec 3679 0 Direct 5.7 3100 6164 3681 18.9%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.65 5.65 0.00 0.00 0.0000 0.0000 20796.19 20796.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.07% 4.58 1 6 3099.77 1739 3651 3087.51 1739 3651 14203 14203 0.00%
crit 18.93% 1.07 0 5 6164.41 3477 7302 4189.98 0 7302 6593 6593 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 70 0.7% 2.8 131.95sec 7617 0 Direct 2.8 6403 12815 7619 18.9%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 2.75 0.00 0.00 0.0000 0.0000 20960.86 20960.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.07% 2.23 0 3 6403.19 6126 6563 6339.81 0 6563 14284 14284 0.00%
crit 18.93% 0.52 0 2 12814.99 12251 13126 5813.11 0 13126 6677 6677 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (799) 0.0% (7.5%) 6.2 51.76sec 38622 31896

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 0.00 0.00 0.00 1.2109 0.0000 0.00 0.00 0.00% 31895.93 31895.93

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 799 7.5% 6.2 51.67sec 38622 0 Direct 18.6 12917 0 12917 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 18.56 0.00 0.00 0.0000 0.0000 239634.13 239634.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.56 15 21 12917.48 847 55328 12890.38 9626 17136 239634 239634 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17110.81
  • base_dd_max:17110.81
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Nadjia
Arcane Power 2.9 127.26sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.85
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 254.45sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.85
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.1 173.68sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.12 0.00 6.65 0.00 4.2090 0.7047 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:1.11
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 49.82sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 1.2093 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.08
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.30sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.4 157.1 5.1sec 1.4sec 3.8sec 73.39% 0.00% 0.9 (1.6) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:18.73%
  • arcane_charge_2:16.88%
  • arcane_charge_3:16.51%
  • arcane_charge_4:21.27%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.3sec 127.3sec 14.7sec 13.97% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.3s / 135.6s
  • trigger_min/max:121.3s / 135.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.97%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 254.5sec 254.5sec 11.7sec 7.18% 12.66% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:252.5s / 263.0s
  • trigger_min/max:252.5s / 263.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.18%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 25.2 0.2 11.5sec 11.4sec 1.9sec 15.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.81%
  • clearcasting_2:0.16%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.21% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • euphoria_1:11.21%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 1.1 0.0 173.6sec 173.6sec 4.2sec 1.57% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:92.0s / 253.1s
  • trigger_min/max:92.0s / 253.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:1.57%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.7sec 34.7sec 11.8sec 35.06% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 51.8s
  • trigger_min/max:13.5s / 51.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.06%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Thrill Seeker 4.4 145.1 78.0sec 2.0sec 66.3sec 97.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.93%
  • thrill_seeker_3:2.92%
  • thrill_seeker_4:2.90%
  • thrill_seeker_5:2.88%
  • thrill_seeker_6:2.86%
  • thrill_seeker_7:2.83%
  • thrill_seeker_8:2.80%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.76%
  • thrill_seeker_11:2.73%
  • thrill_seeker_12:2.70%
  • thrill_seeker_13:2.68%
  • thrill_seeker_14:2.66%
  • thrill_seeker_15:2.64%
  • thrill_seeker_16:2.62%
  • thrill_seeker_17:2.59%
  • thrill_seeker_18:2.57%
  • thrill_seeker_19:2.55%
  • thrill_seeker_20:2.53%
  • thrill_seeker_21:2.51%
  • thrill_seeker_22:2.48%
  • thrill_seeker_23:2.46%
  • thrill_seeker_24:2.44%
  • thrill_seeker_25:2.42%
  • thrill_seeker_26:2.41%
  • thrill_seeker_27:2.40%
  • thrill_seeker_28:2.39%
  • thrill_seeker_29:2.38%
  • thrill_seeker_30:2.37%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.35%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.32%
  • thrill_seeker_35:2.31%
  • thrill_seeker_36:2.31%
  • thrill_seeker_37:2.30%
  • thrill_seeker_38:2.29%
  • thrill_seeker_39:2.28%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.43% 0.77% 7.55% 0.8s 0.0s 4.8s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.091120.122239.871
Evocation143.1262.021339.209215.292136.165351.602
Rune of Power5.9670.06522.31437.47122.70349.624
Touch of the Magi4.7940.00022.67031.02921.39748.317
Arcane Power5.5261.31215.56415.9867.26925.333
Arcane Barrage2.7550.0008.279159.951126.196194.210
Arcane Orb3.4200.01210.48645.31232.24859.219
Mirrors of Torment24.9520.00071.47472.49666.885133.853

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
mana_regen Mana 528.78 368145.18 61.77% 696.21 11566.53 3.05%
Evocation Mana 52.13 53662.42 9.00% 1029.45 0.00 0.00%
Mana Gem Mana 2.74 17387.31 2.92% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.67 139296.10 23.37% 2415.34 6892.99 4.72%
Mirrors of Torment Mana 8.41 17537.82 2.94% 2084.86 3785.40 17.75%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1986.30 2087.64 22207.3 32961.9 234.1 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
arcane_explosion Mana 156.7 598396.2 3818.6 3818.8 2.3
arcane_orb Mana 13.2 5899.0 447.8 447.7 41.7
mirrors_of_torment Mana 2.9 5722.6 2000.0 2001.3 7.3
touch_of_the_magi Mana 6.2 15504.9 2500.0 2498.9 15.5

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Venthyr_Nadjia Damage Per Second
Count 1217
Mean 10714.95
Minimum 9842.13
Maximum 11768.49
Spread ( max - min ) 1926.36
Range [ ( max - min ) / 2 * 100% ] 8.99%
Standard Deviation 297.0695
5th Percentile 10257.80
95th Percentile 11225.07
( 95th Percentile - 5th Percentile ) 967.27
Mean Distribution
Standard Deviation 8.5156
95.00% Confidence Interval ( 10698.26 - 10731.64 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30
0.1% Error 2953
0.1 Scale Factor Error with Delta=300 754
0.05 Scale Factor Error with Delta=300 3014
0.01 Scale Factor Error with Delta=300 75336
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 1217
Mean 4639.17
Minimum 4114.19
Maximum 5400.33
Spread ( max - min ) 1286.15
Range [ ( max - min ) / 2 * 100% ] 13.86%
Standard Deviation 169.7805
5th Percentile 4377.46
95th Percentile 4933.42
( 95th Percentile - 5th Percentile ) 555.96
Mean Distribution
Standard Deviation 4.8668
95.00% Confidence Interval ( 4629.63 - 4648.71 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5146
0.1 Scale Factor Error with Delta=300 247
0.05 Scale Factor Error with Delta=300 985
0.01 Scale Factor Error with Delta=300 24608
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 1217
Mean 10714.95
Minimum 9842.13
Maximum 11768.49
Spread ( max - min ) 1926.36
Range [ ( max - min ) / 2 * 100% ] 8.99%
Damage
Venthyr_Nadjia Damage
Count 1217
Mean 3208117.43
Minimum 2449222.39
Maximum 3856298.54
Spread ( max - min ) 1407076.15
Range [ ( max - min ) / 2 * 100% ] 21.93%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.87 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.85 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.08 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.17 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 156.71 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.67 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 1.11 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.85 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooropnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpooqoopnlpoooopoooopoooorpnpoooopojkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopjkltpoooopnpooroompoooopoooopnpoooopoooopoqooopnpokmpoooopoooopoooopnpoooopoooopoo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 61376.5/63371: 97% mana bloodlust
0:02.313 aoe l arcane_power Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, arcane_charge(4), thrill_seeker
0:02.313 shared_cds s potion Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker
0:02.313 shared_cds t berserking Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:02.313 aoe p arcane_barrage Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:03.228 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:04.141 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.056 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.969 aoe o arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:06.884 aoe o arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:07.800 aoe o arcane_explosion Fluffy_Pillow 61849.3/63371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:08.715 aoe p arcane_barrage Fluffy_Pillow 60508.9/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:09.632 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:10.547 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:11.463 aoe o arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:12.377 aoe o arcane_explosion Fluffy_Pillow 59350.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:13.292 aoe p arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:14.208 aoe o arcane_explosion Fluffy_Pillow 61706.0/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(8), potion_of_deathly_fixation
0:15.124 aoe o arcane_explosion Fluffy_Pillow 62901.9/63371: 99% mana bloodlust, arcane_charge, arcane_power, clearcasting, thrill_seeker(8), potion_of_deathly_fixation
0:16.131 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(2), arcane_power, thrill_seeker(9), potion_of_deathly_fixation
0:17.139 aoe o arcane_explosion Fluffy_Pillow 62149.0/63371: 98% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, thrill_seeker(9), potion_of_deathly_fixation
0:18.146 aoe m rune_of_power Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), thrill_seeker(10), potion_of_deathly_fixation
0:19.154 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(10), potion_of_deathly_fixation
0:20.160 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:21.167 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:22.174 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:23.180 shared_cds r use_mana_gem Venthyr_Nadjia 52199.1/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:23.180 aoe o arcane_explosion Fluffy_Pillow 58536.2/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:24.189 aoe p arcane_barrage Fluffy_Pillow 54815.0/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:25.196 aoe n arcane_orb Fluffy_Pillow 58626.2/63371: 93% mana bloodlust, rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:26.201 aoe p arcane_barrage Fluffy_Pillow 59400.0/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:27.207 aoe o arcane_explosion Fluffy_Pillow 63209.9/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:28.212 aoe o arcane_explosion Fluffy_Pillow 59483.6/63371: 94% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(15)
0:29.217 aoe o arcane_explosion Fluffy_Pillow 55757.4/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, thrill_seeker(15)
0:30.224 aoe o arcane_explosion Fluffy_Pillow 57033.7/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(16)
0:31.232 aoe p arcane_barrage Fluffy_Pillow 53311.3/63371: 84% mana bloodlust, arcane_charge(4), clearcasting, thrill_seeker(16)
0:32.238 aoe o arcane_explosion Fluffy_Pillow 57121.1/63371: 90% mana bloodlust, clearcasting, thrill_seeker(17)
0:33.244 aoe o arcane_explosion Fluffy_Pillow 58396.2/63371: 92% mana bloodlust, arcane_charge, thrill_seeker(17)
0:34.249 aoe o arcane_explosion Fluffy_Pillow 54669.9/63371: 86% mana bloodlust, arcane_charge(2), thrill_seeker(18)
0:35.257 aoe o arcane_explosion Fluffy_Pillow 50947.5/63371: 80% mana bloodlust, arcane_charge(3), clearcasting, thrill_seeker(18)
0:36.263 aoe p arcane_barrage Fluffy_Pillow 52222.5/63371: 82% mana bloodlust, arcane_charge(4), thrill_seeker(19)
0:37.269 aoe o arcane_explosion Fluffy_Pillow 56032.4/63371: 88% mana bloodlust, thrill_seeker(19)
0:38.277 aoe o arcane_explosion Fluffy_Pillow 52310.0/63371: 83% mana bloodlust, arcane_charge, thrill_seeker(20)
0:39.284 aoe o arcane_explosion Fluffy_Pillow 48586.3/63371: 77% mana bloodlust, arcane_charge(2), thrill_seeker(20)
0:40.290 aoe o arcane_explosion Fluffy_Pillow 44861.3/63371: 71% mana bloodlust, arcane_charge(3), thrill_seeker(21)
0:41.296 aoe p arcane_barrage Fluffy_Pillow 41136.4/63371: 65% mana arcane_charge(4), thrill_seeker(21)
0:42.602 aoe o arcane_explosion Fluffy_Pillow 45326.5/63371: 72% mana thrill_seeker(22)
0:43.909 aoe o arcane_explosion Fluffy_Pillow 41983.0/63371: 66% mana arcane_charge, thrill_seeker(22)
0:45.215 aoe o arcane_explosion Fluffy_Pillow 38638.3/63371: 61% mana arcane_charge(2), thrill_seeker(23)
0:46.521 aoe o arcane_explosion Fluffy_Pillow 35293.5/63371: 56% mana arcane_charge(3), thrill_seeker(24)
0:47.827 aoe p arcane_barrage Fluffy_Pillow 31948.8/63371: 50% mana arcane_charge(4), thrill_seeker(24)
0:49.134 aoe n arcane_orb Fluffy_Pillow 36140.2/63371: 57% mana thrill_seeker(25)
0:50.441 aoe p arcane_barrage Fluffy_Pillow 37296.7/63371: 59% mana arcane_charge(4), thrill_seeker(26)
0:51.748 aoe o arcane_explosion Fluffy_Pillow 41488.1/63371: 65% mana thrill_seeker(26)
0:53.055 aoe o arcane_explosion Fluffy_Pillow 38144.6/63371: 60% mana arcane_charge, thrill_seeker(27)
0:54.363 aoe o arcane_explosion Fluffy_Pillow 34802.4/63371: 55% mana arcane_charge(2), clearcasting, thrill_seeker(28)
0:55.668 aoe o arcane_explosion Fluffy_Pillow 36456.4/63371: 58% mana arcane_charge(3), thrill_seeker(28)
0:56.974 aoe p arcane_barrage Fluffy_Pillow 33111.7/63371: 52% mana arcane_charge(4), thrill_seeker(29)
0:58.281 aoe o arcane_explosion Fluffy_Pillow 37303.1/63371: 59% mana thrill_seeker(30)
0:59.588 aoe o arcane_explosion Fluffy_Pillow 33959.6/63371: 54% mana arcane_charge, thrill_seeker(30)
1:00.895 aoe o arcane_explosion Fluffy_Pillow 30616.1/63371: 48% mana arcane_charge(2), thrill_seeker(31)
1:02.203 aoe o arcane_explosion Fluffy_Pillow 27273.9/63371: 43% mana arcane_charge(3), thrill_seeker(32)
1:03.508 aoe p arcane_barrage Fluffy_Pillow 23927.9/63371: 38% mana arcane_charge(4), thrill_seeker(32)
1:04.815 aoe k touch_of_the_magi Fluffy_Pillow 28119.3/63371: 44% mana thrill_seeker(33)
1:06.122 aoe m rune_of_power Fluffy_Pillow 27275.8/63371: 43% mana arcane_charge(4), thrill_seeker(34)
1:07.428 aoe p arcane_barrage Fluffy_Pillow 28931.1/63371: 46% mana arcane_charge(4), rune_of_power, thrill_seeker(34)
1:08.733 aoe o arcane_explosion Fluffy_Pillow 33120.0/63371: 52% mana rune_of_power, thrill_seeker(35)
1:10.040 aoe o arcane_explosion Fluffy_Pillow 29776.5/63371: 47% mana arcane_charge, rune_of_power, thrill_seeker(36)
1:11.346 aoe o arcane_explosion Fluffy_Pillow 26431.7/63371: 42% mana arcane_charge(2), rune_of_power, thrill_seeker(36)
1:12.654 aoe o arcane_explosion Fluffy_Pillow 23089.5/63371: 36% mana arcane_charge(3), rune_of_power, thrill_seeker(37)
1:13.959 aoe p arcane_barrage Fluffy_Pillow 19743.5/63371: 31% mana arcane_charge(4), rune_of_power, thrill_seeker(37)
1:15.266 aoe n arcane_orb Fluffy_Pillow 23934.9/63371: 38% mana rune_of_power, thrill_seeker(38)
1:16.572 aoe p arcane_barrage Fluffy_Pillow 25090.2/63371: 40% mana arcane_charge(4), rune_of_power, thrill_seeker(39)
1:17.880 aoe o arcane_explosion Fluffy_Pillow 29282.8/63371: 46% mana rune_of_power, thrill_seeker(39)
1:19.188 aoe o arcane_explosion Fluffy_Pillow 25940.6/63371: 41% mana arcane_charge, rune_of_power, euphoria
1:20.276 aoe o arcane_explosion Fluffy_Pillow 22319.6/63371: 35% mana arcane_charge(2), thrill_seeker, euphoria
1:21.366 aoe o arcane_explosion Fluffy_Pillow 18701.1/63371: 30% mana arcane_charge(3), thrill_seeker, euphoria
1:22.458 aoe p arcane_barrage Fluffy_Pillow 15085.1/63371: 24% mana arcane_charge(4), thrill_seeker(3), euphoria
1:23.547 aoe o arcane_explosion Fluffy_Pillow 19000.2/63371: 30% mana thrill_seeker(3), euphoria
1:24.635 aoe o arcane_explosion Fluffy_Pillow 15379.2/63371: 24% mana arcane_charge, thrill_seeker(4), euphoria
1:25.725 aoe o arcane_explosion Fluffy_Pillow 11760.7/63371: 19% mana arcane_charge(2), clearcasting, thrill_seeker(4), euphoria
1:26.813 aoe o arcane_explosion Fluffy_Pillow 13139.6/63371: 21% mana arcane_charge(3), thrill_seeker(5), euphoria
1:27.903 aoe p arcane_barrage Fluffy_Pillow 9521.1/63371: 15% mana arcane_charge(4), thrill_seeker(5), euphoria
1:28.991 aoe o arcane_explosion Fluffy_Pillow 13434.9/63371: 21% mana thrill_seeker(6)
1:30.298 aoe o arcane_explosion Fluffy_Pillow 10091.5/63371: 16% mana arcane_charge, clearcasting, thrill_seeker(7)
1:31.604 aoe o arcane_explosion Fluffy_Pillow 11746.7/63371: 19% mana arcane_charge(2), thrill_seeker(7)
1:32.912 aoe o arcane_explosion Fluffy_Pillow 8404.5/63371: 13% mana arcane_charge(3), thrill_seeker(8)
1:34.219 aoe p arcane_barrage Fluffy_Pillow 5061.1/63371: 8% mana arcane_charge(4), thrill_seeker(9)
1:35.526 aoe n arcane_orb Fluffy_Pillow 9252.5/63371: 15% mana thrill_seeker(9)
1:36.834 aoe p arcane_barrage Fluffy_Pillow 10410.2/63371: 16% mana arcane_charge(4), thrill_seeker(10)
1:38.141 aoe o arcane_explosion Fluffy_Pillow 14601.6/63371: 23% mana thrill_seeker(11)
1:39.448 aoe o arcane_explosion Fluffy_Pillow 11258.2/63371: 18% mana arcane_charge, clearcasting, thrill_seeker(11)
1:40.754 aoe o arcane_explosion Fluffy_Pillow 12913.4/63371: 20% mana arcane_charge(2), thrill_seeker(12)
1:42.060 aoe o arcane_explosion Fluffy_Pillow 9568.7/63371: 15% mana arcane_charge(3), thrill_seeker(13)
1:43.366 aoe p arcane_barrage Fluffy_Pillow 6223.9/63371: 10% mana arcane_charge(4), thrill_seeker(13)
1:44.671 aoe o arcane_explosion Fluffy_Pillow 10412.8/63371: 16% mana thrill_seeker(14)
1:45.977 aoe o arcane_explosion Fluffy_Pillow 7068.1/63371: 11% mana arcane_charge, clearcasting, thrill_seeker(14)
1:47.284 aoe o arcane_explosion Fluffy_Pillow 8724.6/63371: 14% mana arcane_charge(2), thrill_seeker(15)
1:48.592 aoe o arcane_explosion Fluffy_Pillow 5382.4/63371: 8% mana arcane_charge(3), thrill_seeker(16)
1:49.898 aoe p arcane_barrage Fluffy_Pillow 2037.6/63371: 3% mana arcane_charge(4), thrill_seeker(16)
1:51.204 aoe k touch_of_the_magi Fluffy_Pillow 6227.8/63371: 10% mana thrill_seeker(17)
1:52.512 aoe m rune_of_power Fluffy_Pillow 5385.6/63371: 8% mana arcane_charge(4), thrill_seeker(18)
1:53.818 aoe p arcane_barrage Fluffy_Pillow 7040.8/63371: 11% mana arcane_charge(4), rune_of_power, thrill_seeker(18)
1:55.125 aoe o arcane_explosion Fluffy_Pillow 11232.2/63371: 18% mana rune_of_power, thrill_seeker(19)
1:56.432 aoe o arcane_explosion Fluffy_Pillow 7888.7/63371: 12% mana arcane_charge, rune_of_power, thrill_seeker(20)
1:57.739 aoe q evocation Venthyr_Nadjia 4545.3/63371: 7% mana arcane_charge(2), rune_of_power, thrill_seeker(20)
2:02.084 aoe o arcane_explosion Fluffy_Pillow 58391.2/63371: 92% mana arcane_charge(2), rune_of_power, thrill_seeker(23)
2:03.390 aoe o arcane_explosion Fluffy_Pillow 55046.5/63371: 87% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(23)
2:04.696 aoe p arcane_barrage Fluffy_Pillow 56701.7/63371: 89% mana arcane_charge(4), rune_of_power, thrill_seeker(24)
2:06.003 aoe n arcane_orb Fluffy_Pillow 60893.1/63371: 96% mana thrill_seeker(25)
2:07.310 aoe l arcane_power Fluffy_Pillow 62049.6/63371: 98% mana arcane_charge(4), thrill_seeker(25)
2:07.310 aoe p arcane_barrage Fluffy_Pillow 62049.6/63371: 98% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(25)
2:08.617 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, rune_of_power, thrill_seeker(26)
2:09.925 aoe o arcane_explosion Fluffy_Pillow 62529.2/63371: 99% mana arcane_charge, arcane_power, clearcasting, rune_of_power, thrill_seeker(26)
2:11.232 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(27)
2:12.537 aoe o arcane_explosion Fluffy_Pillow 62525.4/63371: 99% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(28)
2:13.843 aoe p arcane_barrage Fluffy_Pillow 61680.7/63371: 97% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(28)
2:15.150 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, rune_of_power, thrill_seeker(29)
2:16.456 aoe o arcane_explosion Fluffy_Pillow 62526.7/63371: 99% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(30)
2:17.763 aoe o arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(30)
2:19.069 aoe o arcane_explosion Fluffy_Pillow 60838.5/63371: 96% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(31)
2:20.376 aoe p arcane_barrage Fluffy_Pillow 59995.0/63371: 95% mana arcane_charge(4), arcane_power, thrill_seeker(32)
2:21.684 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, thrill_seeker(32)
2:22.992 aoe o arcane_explosion Fluffy_Pillow 62529.2/63371: 99% mana arcane_charge, thrill_seeker(33)
2:24.298 aoe o arcane_explosion Fluffy_Pillow 59184.5/63371: 93% mana arcane_charge(2), thrill_seeker(34)
2:25.604 aoe o arcane_explosion Fluffy_Pillow 55839.7/63371: 88% mana arcane_charge(3), thrill_seeker(34)
2:26.911 shared_cds r use_mana_gem Venthyr_Nadjia 52496.3/63371: 83% mana arcane_charge(4), thrill_seeker(35)
2:26.911 aoe p arcane_barrage Fluffy_Pillow 58833.4/63371: 93% mana arcane_charge(4), thrill_seeker(35)
2:28.216 aoe n arcane_orb Fluffy_Pillow 63022.3/63371: 99% mana thrill_seeker(36)
2:29.523 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), thrill_seeker(36)
2:30.830 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana thrill_seeker(37)
2:32.137 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, thrill_seeker(38)
2:33.444 aoe o arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), thrill_seeker(38)
2:34.748 aoe o arcane_explosion Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(3), thrill_seeker(39)
2:36.056 aoe p arcane_barrage Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4), euphoria
2:37.147 aoe o arcane_explosion Fluffy_Pillow 53912.6/63371: 85% mana euphoria
2:38.237 aoe j mirrors_of_torment Fluffy_Pillow 50294.1/63371: 79% mana arcane_charge, clearcasting, thrill_seeker, euphoria
2:39.326 aoe k touch_of_the_magi Fluffy_Pillow 49674.4/63371: 78% mana arcane_charge, clearcasting, thrill_seeker, euphoria
2:40.416 aoe m rune_of_power Fluffy_Pillow 48555.9/63371: 77% mana arcane_charge(4), clearcasting, thrill_seeker(3), euphoria
2:41.507 aoe p arcane_barrage Fluffy_Pillow 52473.5/63371: 83% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(3), euphoria
2:42.596 aoe o arcane_explosion Fluffy_Pillow 56388.6/63371: 89% mana clearcasting, rune_of_power, thrill_seeker(4), euphoria
2:43.684 aoe o arcane_explosion Fluffy_Pillow 57767.5/63371: 91% mana arcane_charge, rune_of_power, thrill_seeker(4), euphoria
2:44.775 aoe o arcane_explosion Fluffy_Pillow 54150.3/63371: 85% mana arcane_charge(2), rune_of_power, thrill_seeker(5), euphoria
2:45.863 aoe o arcane_explosion Fluffy_Pillow 50529.3/63371: 80% mana arcane_charge(3), rune_of_power, thrill_seeker(5), euphoria
2:46.953 aoe p arcane_barrage Fluffy_Pillow 49445.6/63371: 78% mana arcane_charge(4), rune_of_power, thrill_seeker(6)
2:48.259 aoe n arcane_orb Fluffy_Pillow 53635.7/63371: 85% mana rune_of_power, thrill_seeker(7)
2:49.568 aoe p arcane_barrage Fluffy_Pillow 54794.8/63371: 86% mana arcane_charge(4), rune_of_power, thrill_seeker(7)
2:50.874 aoe o arcane_explosion Fluffy_Pillow 58984.9/63371: 93% mana rune_of_power, thrill_seeker(8)
2:52.180 aoe o arcane_explosion Fluffy_Pillow 55640.2/63371: 88% mana arcane_charge, rune_of_power, thrill_seeker(9)
2:53.486 aoe o arcane_explosion Fluffy_Pillow 54830.3/63371: 87% mana arcane_charge(2), rune_of_power, thrill_seeker(9)
2:54.791 aoe o arcane_explosion Fluffy_Pillow 51484.3/63371: 81% mana arcane_charge(3), thrill_seeker(10)
2:56.098 aoe p arcane_barrage Fluffy_Pillow 48140.8/63371: 76% mana arcane_charge(4), clearcasting, thrill_seeker(11)
2:57.403 aoe o arcane_explosion Fluffy_Pillow 52329.7/63371: 83% mana clearcasting, thrill_seeker(11)
2:58.709 aoe o arcane_explosion Fluffy_Pillow 53984.9/63371: 85% mana arcane_charge, thrill_seeker(12)
3:00.015 aoe o arcane_explosion Fluffy_Pillow 50640.2/63371: 80% mana arcane_charge(2), thrill_seeker(13)
3:01.322 aoe o arcane_explosion Fluffy_Pillow 47296.7/63371: 75% mana arcane_charge(3), thrill_seeker(13)
3:02.627 aoe p arcane_barrage Fluffy_Pillow 43950.7/63371: 69% mana arcane_charge(4), thrill_seeker(14)
3:03.934 aoe o arcane_explosion Fluffy_Pillow 48142.1/63371: 76% mana thrill_seeker(14)
3:05.242 aoe o arcane_explosion Fluffy_Pillow 44799.9/63371: 71% mana arcane_charge, clearcasting, thrill_seeker(15)
3:06.548 aoe o arcane_explosion Fluffy_Pillow 46455.2/63371: 73% mana arcane_charge(2), thrill_seeker(16)
3:07.855 aoe o arcane_explosion Fluffy_Pillow 43111.7/63371: 68% mana arcane_charge(3), thrill_seeker(16)
3:09.161 aoe p arcane_barrage Fluffy_Pillow 39766.9/63371: 63% mana arcane_charge(4), thrill_seeker(17)
3:10.467 aoe n arcane_orb Fluffy_Pillow 43957.1/63371: 69% mana thrill_seeker(18)
3:11.773 aoe p arcane_barrage Fluffy_Pillow 45112.3/63371: 71% mana arcane_charge(4), thrill_seeker(18)
3:13.079 aoe o arcane_explosion Fluffy_Pillow 49302.4/63371: 78% mana thrill_seeker(19)
3:14.387 aoe o arcane_explosion Fluffy_Pillow 45960.2/63371: 73% mana arcane_charge, clearcasting, thrill_seeker(20)
3:15.692 aoe o arcane_explosion Fluffy_Pillow 47614.2/63371: 75% mana arcane_charge(2), thrill_seeker(20)
3:16.999 aoe o arcane_explosion Fluffy_Pillow 44270.8/63371: 70% mana arcane_charge(3), thrill_seeker(21)
3:18.306 aoe p arcane_barrage Fluffy_Pillow 40927.3/63371: 65% mana arcane_charge(4), thrill_seeker(22)
3:19.611 aoe o arcane_explosion Fluffy_Pillow 45116.1/63371: 71% mana thrill_seeker(22)
3:20.917 aoe o arcane_explosion Fluffy_Pillow 41771.4/63371: 66% mana arcane_charge, thrill_seeker(23)
3:22.222 aoe o arcane_explosion Fluffy_Pillow 38425.4/63371: 61% mana arcane_charge(2), thrill_seeker(24)
3:23.527 aoe o arcane_explosion Fluffy_Pillow 35079.4/63371: 55% mana arcane_charge(3), thrill_seeker(24)
3:24.833 aoe p arcane_barrage Fluffy_Pillow 31734.7/63371: 50% mana arcane_charge(4), thrill_seeker(25)
3:26.139 aoe k touch_of_the_magi Fluffy_Pillow 35924.8/63371: 57% mana thrill_seeker(26)
3:27.445 aoe m rune_of_power Fluffy_Pillow 35080.0/63371: 55% mana arcane_charge(4), thrill_seeker(26)
3:28.752 aoe p arcane_barrage Fluffy_Pillow 36736.6/63371: 58% mana arcane_charge(4), rune_of_power, thrill_seeker(27)
3:30.058 aoe o arcane_explosion Fluffy_Pillow 40926.7/63371: 65% mana rune_of_power, thrill_seeker(28)
3:31.364 aoe o arcane_explosion Fluffy_Pillow 37581.9/63371: 59% mana arcane_charge, rune_of_power, thrill_seeker(28)
3:32.669 aoe o arcane_explosion Fluffy_Pillow 34235.9/63371: 54% mana arcane_charge(2), rune_of_power, thrill_seeker(29)
3:33.975 aoe o arcane_explosion Fluffy_Pillow 30891.2/63371: 49% mana arcane_charge(3), rune_of_power, thrill_seeker(29)
3:35.282 aoe p arcane_barrage Fluffy_Pillow 27547.7/63371: 43% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(30)
3:36.589 aoe n arcane_orb Fluffy_Pillow 31739.1/63371: 50% mana clearcasting, rune_of_power, thrill_seeker(31)
3:37.895 aoe p arcane_barrage Fluffy_Pillow 32894.4/63371: 52% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(31)
3:39.201 aoe o arcane_explosion Fluffy_Pillow 37084.5/63371: 59% mana clearcasting, rune_of_power, thrill_seeker(32)
3:40.507 aoe o arcane_explosion Fluffy_Pillow 38739.8/63371: 61% mana arcane_charge, rune_of_power, thrill_seeker(33)
3:41.816 aoe o arcane_explosion Fluffy_Pillow 35398.8/63371: 56% mana arcane_charge(2), thrill_seeker(33)
3:43.123 aoe o arcane_explosion Fluffy_Pillow 32055.4/63371: 51% mana arcane_charge(3), thrill_seeker(34)
3:44.430 aoe p arcane_barrage Fluffy_Pillow 28711.9/63371: 45% mana arcane_charge(4), thrill_seeker(35)
3:45.738 aoe o arcane_explosion Fluffy_Pillow 32904.5/63371: 52% mana thrill_seeker(35)
3:47.044 aoe o arcane_explosion Fluffy_Pillow 29559.8/63371: 47% mana arcane_charge, thrill_seeker(36)
3:48.351 aoe o arcane_explosion Fluffy_Pillow 26216.3/63371: 41% mana arcane_charge(2), thrill_seeker(37)
3:49.658 aoe o arcane_explosion Fluffy_Pillow 22872.9/63371: 36% mana arcane_charge(3), thrill_seeker(37)
3:50.965 aoe p arcane_barrage Fluffy_Pillow 19529.4/63371: 31% mana arcane_charge(4), clearcasting, thrill_seeker(38)
3:52.271 aoe o arcane_explosion Fluffy_Pillow 23719.5/63371: 37% mana clearcasting, thrill_seeker(39)
3:53.579 aoe o arcane_explosion Fluffy_Pillow 25377.3/63371: 40% mana arcane_charge, thrill_seeker(39)
3:54.885 aoe o arcane_explosion Fluffy_Pillow 22032.6/63371: 35% mana arcane_charge(2), euphoria
3:55.974 aoe o arcane_explosion Fluffy_Pillow 18412.8/63371: 29% mana arcane_charge(3), euphoria
3:57.063 aoe p arcane_barrage Fluffy_Pillow 14793.0/63371: 23% mana arcane_charge(4), thrill_seeker, euphoria
3:58.153 aoe n arcane_orb Fluffy_Pillow 18709.4/63371: 30% mana thrill_seeker(3), euphoria
3:59.244 aoe p arcane_barrage Fluffy_Pillow 19592.1/63371: 31% mana arcane_charge(4), thrill_seeker(3), euphoria
4:00.334 aoe o arcane_explosion Fluffy_Pillow 23508.5/63371: 37% mana thrill_seeker(4), euphoria
4:01.422 aoe o arcane_explosion Fluffy_Pillow 19887.5/63371: 31% mana arcane_charge, thrill_seeker(4), euphoria
4:02.512 aoe o arcane_explosion Fluffy_Pillow 16269.0/63371: 26% mana arcane_charge(2), thrill_seeker(5), euphoria
4:03.603 aoe o arcane_explosion Fluffy_Pillow 12651.7/63371: 20% mana arcane_charge(3), thrill_seeker(5), euphoria
4:04.694 aoe p arcane_barrage Fluffy_Pillow 9034.5/63371: 14% mana arcane_charge(4), thrill_seeker(6)
4:06.001 aoe o arcane_explosion Fluffy_Pillow 13225.9/63371: 21% mana thrill_seeker(7)
4:07.307 aoe o arcane_explosion Fluffy_Pillow 9881.1/63371: 16% mana arcane_charge, thrill_seeker(7)
4:08.614 aoe o arcane_explosion Fluffy_Pillow 6537.7/63371: 10% mana arcane_charge(2), clearcasting, thrill_seeker(8)
4:09.921 aoe o arcane_explosion Fluffy_Pillow 8194.2/63371: 13% mana arcane_charge(3), thrill_seeker(8)
4:11.227 aoe p arcane_barrage Fluffy_Pillow 4849.5/63371: 8% mana arcane_charge(4), thrill_seeker(9)
4:12.534 aoe j mirrors_of_torment Fluffy_Pillow 9040.8/63371: 14% mana thrill_seeker(10)
4:13.842 aoe k touch_of_the_magi Fluffy_Pillow 8698.6/63371: 14% mana thrill_seeker(10)
4:15.148 aoe l arcane_power Fluffy_Pillow 7853.9/63371: 12% mana arcane_charge(4), thrill_seeker(11)
4:15.148 shared_cds t berserking Fluffy_Pillow 7853.9/63371: 12% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(11)
4:15.148 aoe p arcane_barrage Fluffy_Pillow 7853.9/63371: 12% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(11)
4:16.335 aoe o arcane_explosion Fluffy_Pillow 14428.1/63371: 23% mana berserking, arcane_power, rune_of_power, thrill_seeker(12)
4:17.522 aoe o arcane_explosion Fluffy_Pillow 13432.5/63371: 21% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(12)
4:18.711 aoe o arcane_explosion Fluffy_Pillow 12439.5/63371: 20% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(13)
4:19.898 aoe o arcane_explosion Fluffy_Pillow 11443.9/63371: 18% mana berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(13)
4:21.088 aoe p arcane_barrage Fluffy_Pillow 10452.1/63371: 16% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(14)
4:22.277 aoe n arcane_orb Fluffy_Pillow 17028.8/63371: 27% mana berserking, arcane_power, rune_of_power, thrill_seeker(15)
4:23.465 aoe p arcane_barrage Fluffy_Pillow 18284.5/63371: 29% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(15)
4:24.655 aoe o arcane_explosion Fluffy_Pillow 22327.6/63371: 35% mana berserking, arcane_power, rune_of_power, thrill_seeker(16)
4:25.843 aoe o arcane_explosion Fluffy_Pillow 21333.3/63371: 34% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(16)
4:27.030 shared_cds r use_mana_gem Venthyr_Nadjia 20337.8/63371: 32% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(17)
4:27.030 aoe o arcane_explosion Fluffy_Pillow 26674.9/63371: 42% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(17)
4:28.217 aoe o arcane_explosion Fluffy_Pillow 28214.2/63371: 45% mana arcane_charge(3), arcane_power, thrill_seeker(18)
4:29.524 aoe m rune_of_power Fluffy_Pillow 27370.7/63371: 43% mana arcane_charge(4), arcane_power, thrill_seeker(18)
4:30.830 aoe p arcane_barrage Fluffy_Pillow 29026.0/63371: 46% mana arcane_charge(4), rune_of_power, thrill_seeker(19)
4:32.135 aoe o arcane_explosion Fluffy_Pillow 33214.9/63371: 52% mana rune_of_power, thrill_seeker(20)
4:33.442 aoe o arcane_explosion Fluffy_Pillow 29871.4/63371: 47% mana arcane_charge, rune_of_power, thrill_seeker(20)
4:34.748 aoe o arcane_explosion Fluffy_Pillow 26526.6/63371: 42% mana arcane_charge(2), rune_of_power, thrill_seeker(21)
4:36.053 aoe o arcane_explosion Fluffy_Pillow 23180.6/63371: 37% mana arcane_charge(3), rune_of_power, thrill_seeker(22)
4:37.359 aoe p arcane_barrage Fluffy_Pillow 19835.9/63371: 31% mana arcane_charge(4), rune_of_power, thrill_seeker(22)
4:38.666 aoe o arcane_explosion Fluffy_Pillow 24027.3/63371: 38% mana rune_of_power, thrill_seeker(23)
4:39.971 aoe o arcane_explosion Fluffy_Pillow 20681.3/63371: 33% mana arcane_charge, rune_of_power, thrill_seeker(23)
4:41.278 aoe o arcane_explosion Fluffy_Pillow 17337.8/63371: 27% mana arcane_charge(2), rune_of_power, thrill_seeker(24)
4:42.582 aoe o arcane_explosion Fluffy_Pillow 13990.5/63371: 22% mana arcane_charge(3), rune_of_power, thrill_seeker(25)
4:43.888 aoe p arcane_barrage Fluffy_Pillow 10645.8/63371: 17% mana arcane_charge(4), thrill_seeker(25)
4:45.192 aoe n arcane_orb Fluffy_Pillow 14833.4/63371: 23% mana thrill_seeker(26)
4:46.499 aoe p arcane_barrage Fluffy_Pillow 15989.9/63371: 25% mana arcane_charge(4), thrill_seeker(27)
4:47.806 aoe o arcane_explosion Fluffy_Pillow 20181.3/63371: 32% mana thrill_seeker(27)
4:49.111 aoe o arcane_explosion Fluffy_Pillow 16835.3/63371: 27% mana arcane_charge, thrill_seeker(28)
4:50.417 aoe o arcane_explosion Fluffy_Pillow 13490.6/63371: 21% mana arcane_charge(2), clearcasting, thrill_seeker(29)
4:51.722 aoe o arcane_explosion Fluffy_Pillow 15144.5/63371: 24% mana arcane_charge(3), thrill_seeker(29)
4:53.029 aoe p arcane_barrage Fluffy_Pillow 11801.1/63371: 19% mana arcane_charge(4), thrill_seeker(30)
4:54.337 aoe o arcane_explosion Fluffy_Pillow 15993.7/63371: 25% mana thrill_seeker(31)
4:55.642 aoe o arcane_explosion Fluffy_Pillow 12647.7/63371: 20% mana arcane_charge, thrill_seeker(31)
4:56.947 aoe o arcane_explosion Fluffy_Pillow 9301.7/63371: 15% mana arcane_charge(2), thrill_seeker(32)
4:58.253 aoe o arcane_explosion Fluffy_Pillow 5957.0/63371: 9% mana arcane_charge(3), thrill_seeker(33)
4:59.560 aoe p arcane_barrage Fluffy_Pillow 2613.5/63371: 4% mana arcane_charge(4), thrill_seeker(33)
5:00.865 aoe o arcane_explosion Fluffy_Pillow 6802.4/63371: 11% mana thrill_seeker(34)
5:02.170 aoe q evocation Fluffy_Pillow 3456.4/63371: 5% mana arcane_charge, thrill_seeker(35)
5:06.514 aoe o arcane_explosion Fluffy_Pillow 57301.0/63371: 90% mana arcane_charge, thrill_seeker(37)
5:07.822 aoe o arcane_explosion Fluffy_Pillow 53958.8/63371: 85% mana arcane_charge(2), thrill_seeker(37)
5:09.132 aoe o arcane_explosion Fluffy_Pillow 50619.1/63371: 80% mana arcane_charge(3), thrill_seeker(38)
5:10.439 aoe p arcane_barrage Fluffy_Pillow 47275.7/63371: 75% mana arcane_charge(4), thrill_seeker(39)
5:11.746 aoe n arcane_orb Fluffy_Pillow 51467.1/63371: 81% mana thrill_seeker(39)
5:13.054 aoe p arcane_barrage Fluffy_Pillow 52624.9/63371: 83% mana arcane_charge(4), euphoria
5:14.143 aoe o arcane_explosion Fluffy_Pillow 56539.9/63371: 89% mana thrill_seeker, euphoria
5:15.232 aoe k touch_of_the_magi Fluffy_Pillow 52920.2/63371: 84% mana arcane_charge, thrill_seeker, euphoria
5:16.321 aoe m rune_of_power Fluffy_Pillow 51800.4/63371: 82% mana arcane_charge(4), thrill_seeker(3), euphoria
5:17.410 aoe p arcane_barrage Fluffy_Pillow 53180.6/63371: 84% mana arcane_charge(4), rune_of_power, thrill_seeker(3), euphoria
5:18.499 aoe o arcane_explosion Fluffy_Pillow 57095.7/63371: 90% mana rune_of_power, thrill_seeker(4), euphoria
5:19.587 aoe o arcane_explosion Fluffy_Pillow 53474.7/63371: 84% mana arcane_charge, rune_of_power, thrill_seeker(4), euphoria
5:20.676 aoe o arcane_explosion Fluffy_Pillow 49854.9/63371: 79% mana arcane_charge(2), rune_of_power, thrill_seeker(5), euphoria
5:21.765 aoe o arcane_explosion Fluffy_Pillow 46235.1/63371: 73% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(5), euphoria
5:22.855 aoe p arcane_barrage Fluffy_Pillow 47616.6/63371: 75% mana arcane_charge(4), rune_of_power, thrill_seeker(6)
5:24.161 aoe o arcane_explosion Fluffy_Pillow 51806.8/63371: 82% mana rune_of_power, thrill_seeker(7)
5:25.471 aoe o arcane_explosion Fluffy_Pillow 48467.1/63371: 76% mana arcane_charge, rune_of_power, thrill_seeker(7)
5:26.778 aoe o arcane_explosion Fluffy_Pillow 45123.6/63371: 71% mana arcane_charge(2), rune_of_power, thrill_seeker(8)
5:28.085 aoe o arcane_explosion Fluffy_Pillow 41780.2/63371: 66% mana arcane_charge(3), rune_of_power, thrill_seeker(9)
5:29.390 aoe p arcane_barrage Fluffy_Pillow 38434.1/63371: 61% mana arcane_charge(4), rune_of_power, thrill_seeker(9)
5:30.698 aoe o arcane_explosion Fluffy_Pillow 42626.8/63371: 67% mana thrill_seeker(10)
5:32.004 aoe o arcane_explosion Fluffy_Pillow 39282.1/63371: 62% mana arcane_charge, thrill_seeker(11)
5:33.312 aoe o arcane_explosion Fluffy_Pillow 35939.9/63371: 57% mana arcane_charge(2), clearcasting, thrill_seeker(11)
5:34.619 aoe o arcane_explosion Fluffy_Pillow 37596.4/63371: 59% mana arcane_charge(3), thrill_seeker(12)
5:35.925 aoe p arcane_barrage Fluffy_Pillow 34251.6/63371: 54% mana arcane_charge(4), thrill_seeker(12)
5:37.231 aoe n arcane_orb Fluffy_Pillow 38441.8/63371: 61% mana thrill_seeker(13)
5:38.537 aoe p arcane_barrage Fluffy_Pillow 39597.0/63371: 62% mana arcane_charge(4), thrill_seeker(14)
5:39.844 aoe o arcane_explosion Fluffy_Pillow 43788.4/63371: 69% mana thrill_seeker(14)
5:41.150 aoe o arcane_explosion Fluffy_Pillow 40443.7/63371: 64% mana arcane_charge, clearcasting, thrill_seeker(15)
5:42.457 aoe o arcane_explosion Fluffy_Pillow 42100.2/63371: 66% mana arcane_charge(2), thrill_seeker(16)
5:43.762 aoe o arcane_explosion Fluffy_Pillow 38754.2/63371: 61% mana arcane_charge(3), thrill_seeker(16)
5:45.067 aoe p arcane_barrage Fluffy_Pillow 35408.2/63371: 56% mana arcane_charge(4), thrill_seeker(17)
5:46.376 aoe o arcane_explosion Fluffy_Pillow 39602.1/63371: 62% mana thrill_seeker(18)
5:47.682 aoe o arcane_explosion Fluffy_Pillow 36257.4/63371: 57% mana arcane_charge, thrill_seeker(18)
5:48.989 aoe o arcane_explosion Fluffy_Pillow 32913.9/63371: 52% mana arcane_charge(2), thrill_seeker(19)
5:50.296 aoe o arcane_explosion Fluffy_Pillow 29570.4/63371: 47% mana arcane_charge(3), clearcasting, thrill_seeker(20)
5:51.603 aoe p arcane_barrage Fluffy_Pillow 31227.0/63371: 49% mana arcane_charge(4), thrill_seeker(20)
5:52.909 aoe o arcane_explosion Fluffy_Pillow 35417.1/63371: 56% mana thrill_seeker(21)
5:54.216 aoe o arcane_explosion Fluffy_Pillow 32073.6/63371: 51% mana arcane_charge, thrill_seeker(22)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Nadjia"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=331586//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Theotar : 10735 dps, 4644 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10735.0 10735.0 17.1 / 0.159% 1201.2 / 11.2% 5.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
2050.0 1962.1 Mana 0.00% 49.5 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 10735
Arcane Barrage 3945 36.8% 57.0 5.26sec 20766 16642 Direct 170.9 5817 11637 6932 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.04 170.88 0.00 0.00 1.2478 0.0000 1184468.17 1184468.17 0.00% 16641.63 16641.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 138.11 100 175 5816.56 2082 26974 5809.10 5189 6655 803047 803047 0.00%
crit 19.18% 32.77 13 53 11636.99 4164 53948 11627.28 7477 17931 381421 381421 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.04
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 273 2.5% 43.0 6.55sec 1903 0 Direct 128.9 531 1063 634 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.98 128.93 0.00 0.00 0.0000 0.0000 81781.99 81781.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 103.97 70 134 531.49 316 664 530.77 495 575 55246 55246 0.00%
crit 19.36% 24.96 11 42 1063.07 633 1329 1061.91 908 1199 26536 26536 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4641 43.2% 153.6 1.92sec 9062 7294 Direct 460.9 2535 5061 3021 19.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.63 460.90 0.00 0.00 1.2423 0.0000 1392187.78 1392187.78 0.00% 7294.21 7294.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 372.23 279 465 2535.10 1958 4616 2534.94 2439 2669 943520 943520 0.00%
crit 19.24% 88.67 46 129 5061.46 3916 9232 5060.24 4502 5693 448668 448668 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:153.64
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (838) 0.0% (7.8%) 13.1 23.50sec 19139 15347

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.14 0.00 0.00 0.00 1.2471 0.0000 0.00 0.00 0.00% 15347.09 15347.09

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.14
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 838 7.8% 39.4 23.50sec 6390 0 Direct 39.4 5349 10695 6392 19.5%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.35 39.35 0.00 0.00 0.0000 0.0000 251446.65 251446.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 31.67 20 45 5349.11 3869 9122 5347.68 4655 6048 169338 169338 0.00%
crit 19.52% 7.68 0 18 10694.86 7739 18245 10670.26 0 15477 82108 82108 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.6%) 14.6 1.78sec 1387 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.6% 14.6 1.78sec 1387 0 Direct 14.6 1164 2327 1387 19.2%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.65 14.65 0.00 0.00 0.0000 0.0000 20321.16 20321.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 11.83 4 19 1163.53 1164 1164 1163.53 1164 1164 13768 13768 0.00%
crit 19.22% 2.82 0 8 2327.06 2327 2327 2200.86 0 2327 6553 6553 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1758 18.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1756.86 1756.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.35% 0.81 0 1 1480.68 1481 1481 1204.49 0 1481 1204 1204 0.00%
crit 18.65% 0.19 0 1 2961.35 2961 2961 552.36 0 2961 552 552 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5783 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.2% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5782.78 5782.78 0.00% 49.10 49.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 72.78 57 85 53.92 43 60 53.92 53 56 3925 3925 0.00%
crit 19.13% 17.22 5 33 107.91 86 120 107.92 94 120 1858 1858 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (129) 0.0% (1.2%) 2.7 138.63sec 14422 11041

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.69 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 11041.30 11041.30

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.70
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 64 0.6% 5.3 55.35sec 3624 0 Direct 5.3 3036 6045 3624 19.6%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 5.30 0.00 0.00 0.0000 0.0000 19212.34 19212.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 4.26 1 6 3035.61 1739 3651 3022.83 1739 3651 12937 12937 0.00%
crit 19.58% 1.04 0 4 6044.87 3477 7302 4115.98 0 7302 6275 6275 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 65 0.6% 2.6 139.81sec 7589 0 Direct 2.6 6390 12773 7583 18.8%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.58 2.58 0.00 0.00 0.0000 0.0000 19586.77 19586.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.22% 2.10 0 3 6390.36 6126 6563 6267.19 0 6563 13395 13395 0.00%
crit 18.78% 0.48 0 3 12773.18 12251 13126 5195.34 0 13126 6192 6192 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (815) 0.0% (7.6%) 6.1 52.76sec 40011 31823

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.11 0.00 0.00 0.00 1.2573 0.0000 0.00 0.00 0.00% 31823.24 31823.24

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.12
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 815 7.6% 6.1 52.65sec 40011 0 Direct 18.3 13385 0 13385 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.11 18.27 0.00 0.00 0.0000 0.0000 244307.02 244307.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.27 15 21 13384.61 404 55006 13379.68 8465 17599 244307 244307 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20015.23
  • base_dd_max:20015.23
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Theotar
Arcane Power 2.8 129.11sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.82 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.82
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.32sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.82 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.82
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.8 197.98sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.82 0.00 4.85 0.00 4.3007 0.7221 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.82
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 50.78sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.96 0.00 0.00 0.00 1.2562 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.99
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 124.32sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.72
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.8 154.4 5.2sec 1.4sec 3.8sec 72.85% 0.00% 0.4 (0.5) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.65%
  • arcane_charge_2:16.26%
  • arcane_charge_3:16.45%
  • arcane_charge_4:21.50%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.2sec 129.2sec 14.7sec 13.78% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.7s / 135.2s
  • trigger_min/max:121.7s / 135.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.78%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.5sec 258.5sec 11.7sec 7.02% 23.51% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:246.3s / 264.5s
  • trigger_min/max:246.3s / 264.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.02%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.4 0.2 11.9sec 11.8sec 2.0sec 16.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.09%
  • clearcasting_2:0.22%
  • clearcasting_3:0.04%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.8 0.0 177.3sec 177.3sec 4.3sec 1.17% 0.00% 3.2 (3.2) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:112.8s / 244.7s
  • trigger_min/max:112.8s / 244.7s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 4.3s

Stack Uptimes

  • evocation_1:1.17%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.4sec 35.4sec 11.8sec 34.51% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 56.6s
  • trigger_min/max:13.1s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.51%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Soothing Shade 4.2 0.0 63.3sec 63.3sec 11.7sec 16.28% 0.00% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 207.2s
  • trigger_min/max:20.0s / 207.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.28%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.77% 0.77% 8.75% 0.8s 0.0s 6.0s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.091120.122239.871
Evocation177.86322.789353.572239.936141.167357.925
Rune of Power6.8031.13924.70241.99226.61257.274
Touch of the Magi5.6230.00021.05135.82225.30655.966
Arcane Power6.7581.66715.20819.4784.02626.835
Arcane Barrage2.7640.0039.580158.714124.782191.462
Arcane Orb3.4790.00010.48746.01435.04059.761
Mirrors of Torment29.5340.00074.54585.26061.244137.745

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
mana_regen Mana 520.54 375410.47 63.75% 721.19 13095.17 3.37%
Evocation Mana 38.93 39551.08 6.72% 1016.05 0.00 0.00%
Mana Gem Mana 2.72 17511.86 2.97% 6445.41 0.00 0.00%
Arcane Barrage Mana 57.04 140247.96 23.82% 2458.85 7635.08 5.16%
Mirrors of Torment Mana 7.88 16113.27 2.74% 2043.79 4320.94 21.15%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1962.05 2049.97 25060.2 36387.1 1055.0 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
arcane_explosion Mana 153.6 587625.7 3824.8 3824.9 2.4
arcane_orb Mana 13.1 5904.3 449.5 449.4 42.6
mirrors_of_torment Mana 2.7 5380.4 2000.0 2000.0 7.2
touch_of_the_magi Mana 6.1 15261.6 2500.0 2499.4 16.0

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Venthyr_Theotar Damage Per Second
Count 1217
Mean 10735.02
Minimum 9661.84
Maximum 11842.85
Spread ( max - min ) 2181.01
Range [ ( max - min ) / 2 * 100% ] 10.16%
Standard Deviation 304.3231
5th Percentile 10246.22
95th Percentile 11230.86
( 95th Percentile - 5th Percentile ) 984.64
Mean Distribution
Standard Deviation 8.7235
95.00% Confidence Interval ( 10717.92 - 10752.12 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3088
0.1 Scale Factor Error with Delta=300 791
0.05 Scale Factor Error with Delta=300 3163
0.01 Scale Factor Error with Delta=300 79060
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 1217
Mean 4643.79
Minimum 4064.05
Maximum 5313.86
Spread ( max - min ) 1249.81
Range [ ( max - min ) / 2 * 100% ] 13.46%
Standard Deviation 175.2568
5th Percentile 4367.01
95th Percentile 4939.25
( 95th Percentile - 5th Percentile ) 572.24
Mean Distribution
Standard Deviation 5.0238
95.00% Confidence Interval ( 4633.94 - 4653.64 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5472
0.1 Scale Factor Error with Delta=300 263
0.05 Scale Factor Error with Delta=300 1049
0.01 Scale Factor Error with Delta=300 26221
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 1217
Mean 10735.02
Minimum 9661.84
Maximum 11842.85
Spread ( max - min ) 2181.01
Range [ ( max - min ) / 2 * 100% ] 10.16%
Damage
Venthyr_Theotar Damage
Count 1217
Mean 3215068.75
Minimum 2447302.89
Maximum 3909771.95
Spread ( max - min ) 1462469.06
Range [ ( max - min ) / 2 * 100% ] 22.74%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.70 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.12 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.82 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.99 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.14 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 153.64 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.04 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.82 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.72 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.82 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooorpnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooqopnpoooopokmpoooopnpoooolpoooopoooopnpoooorpoooopjkmpnpoooopoooopoooopnpoooopoooopoooopkmpnpoooopoooopoooopnpoooopoooopoooopjkltpnpoooopooroompoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooop

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 61376.5/63371: 97% mana bloodlust
0:02.311 aoe l arcane_power Fluffy_Pillow 60150.3/63371: 95% mana bloodlust, arcane_charge(4)
0:02.311 shared_cds s potion Fluffy_Pillow 60150.3/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:02.311 shared_cds t berserking Fluffy_Pillow 60150.3/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.311 aoe p arcane_barrage Fluffy_Pillow 60150.3/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.225 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.139 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.053 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.967 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.880 aoe o arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.796 aoe o arcane_explosion Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.711 aoe p arcane_barrage Fluffy_Pillow 58007.7/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.626 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.540 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.454 aoe o arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.368 aoe o arcane_explosion Fluffy_Pillow 67775.1/72371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:13.282 aoe p arcane_barrage Fluffy_Pillow 66598.1/72371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:14.196 aoe o arcane_explosion Fluffy_Pillow 70815.9/72371: 98% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:15.109 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana bloodlust, arcane_charge, arcane_power, soothing_shade, potion_of_deathly_fixation
0:16.115 aoe o arcane_explosion Fluffy_Pillow 71327.5/72371: 99% mana bloodlust, arcane_charge(2), arcane_power, soothing_shade, potion_of_deathly_fixation
0:17.121 aoe o arcane_explosion Fluffy_Pillow 70283.7/72371: 97% mana bloodlust, arcane_charge(3), arcane_power, soothing_shade, potion_of_deathly_fixation
0:18.129 aoe m rune_of_power Fluffy_Pillow 69242.7/72371: 96% mana bloodlust, arcane_charge(4), soothing_shade, potion_of_deathly_fixation
0:19.135 aoe p arcane_barrage Fluffy_Pillow 70698.8/72371: 98% mana bloodlust, arcane_charge(4), rune_of_power, soothing_shade, potion_of_deathly_fixation
0:20.140 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana bloodlust, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:21.145 aoe o arcane_explosion Fluffy_Pillow 68826.1/72371: 95% mana bloodlust, arcane_charge, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:22.151 aoe o arcane_explosion Fluffy_Pillow 65282.2/72371: 90% mana bloodlust, arcane_charge(2), rune_of_power, soothing_shade, potion_of_deathly_fixation
0:23.156 aoe o arcane_explosion Fluffy_Pillow 61736.9/72371: 85% mana bloodlust, arcane_charge(3), rune_of_power, soothing_shade, potion_of_deathly_fixation
0:24.162 shared_cds r use_mana_gem Venthyr_Theotar 50956.2/63371: 80% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.162 aoe p arcane_barrage Fluffy_Pillow 57293.3/63371: 90% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.168 aoe n arcane_orb Fluffy_Pillow 61103.2/63371: 96% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.174 aoe p arcane_barrage Fluffy_Pillow 61878.3/63371: 98% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.182 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.188 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.195 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.200 aoe o arcane_explosion Fluffy_Pillow 52196.5/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.208 aoe p arcane_barrage Fluffy_Pillow 48474.1/63371: 76% mana bloodlust, arcane_charge(4)
0:32.214 aoe o arcane_explosion Fluffy_Pillow 52284.0/63371: 83% mana bloodlust
0:33.220 aoe o arcane_explosion Fluffy_Pillow 48559.0/63371: 77% mana bloodlust, arcane_charge
0:34.226 aoe o arcane_explosion Fluffy_Pillow 44834.1/63371: 71% mana bloodlust, arcane_charge(2)
0:35.232 aoe o arcane_explosion Fluffy_Pillow 41109.1/63371: 65% mana bloodlust, arcane_charge(3)
0:36.239 aoe p arcane_barrage Fluffy_Pillow 37385.4/63371: 59% mana bloodlust, arcane_charge(4)
0:37.247 aoe o arcane_explosion Fluffy_Pillow 41197.8/63371: 65% mana bloodlust
0:38.254 aoe o arcane_explosion Fluffy_Pillow 37474.1/63371: 59% mana bloodlust, arcane_charge
0:39.261 aoe o arcane_explosion Fluffy_Pillow 33750.4/63371: 53% mana bloodlust, arcane_charge(2)
0:40.268 aoe o arcane_explosion Fluffy_Pillow 30026.7/63371: 47% mana bloodlust, arcane_charge(3)
0:41.275 aoe p arcane_barrage Fluffy_Pillow 26303.0/63371: 42% mana arcane_charge(4), clearcasting
0:42.580 aoe o arcane_explosion Fluffy_Pillow 30491.9/63371: 48% mana clearcasting
0:43.888 aoe o arcane_explosion Fluffy_Pillow 32149.7/63371: 51% mana arcane_charge
0:45.195 aoe o arcane_explosion Fluffy_Pillow 28806.2/63371: 45% mana arcane_charge(2)
0:46.502 aoe o arcane_explosion Fluffy_Pillow 25462.7/63371: 40% mana arcane_charge(3)
0:47.808 aoe p arcane_barrage Fluffy_Pillow 22118.0/63371: 35% mana arcane_charge(4), clearcasting
0:49.115 aoe n arcane_orb Fluffy_Pillow 26309.4/63371: 42% mana clearcasting
0:50.421 aoe p arcane_barrage Fluffy_Pillow 27464.6/63371: 43% mana arcane_charge(4), clearcasting
0:51.727 aoe o arcane_explosion Fluffy_Pillow 31654.7/63371: 50% mana clearcasting
0:53.034 aoe o arcane_explosion Fluffy_Pillow 33311.3/63371: 53% mana arcane_charge
0:54.340 aoe o arcane_explosion Fluffy_Pillow 29966.5/63371: 47% mana arcane_charge(2)
0:55.647 aoe o arcane_explosion Fluffy_Pillow 30404.1/72371: 42% mana arcane_charge(3), soothing_shade
0:56.953 aoe p arcane_barrage Fluffy_Pillow 27294.4/72371: 38% mana arcane_charge(4), soothing_shade
0:58.258 aoe o arcane_explosion Fluffy_Pillow 32078.2/72371: 44% mana soothing_shade
0:59.564 aoe o arcane_explosion Fluffy_Pillow 28968.5/72371: 40% mana arcane_charge, soothing_shade
1:00.870 aoe o arcane_explosion Fluffy_Pillow 25858.8/72371: 36% mana arcane_charge(2), soothing_shade
1:02.176 aoe o arcane_explosion Fluffy_Pillow 22749.2/72371: 31% mana arcane_charge(3), soothing_shade
1:03.482 aoe p arcane_barrage Fluffy_Pillow 19639.5/72371: 27% mana arcane_charge(4), soothing_shade
1:04.788 aoe k touch_of_the_magi Fluffy_Pillow 24424.7/72371: 34% mana soothing_shade
1:06.094 aoe m rune_of_power Fluffy_Pillow 23815.1/72371: 33% mana arcane_charge(4), soothing_shade
1:07.401 aoe p arcane_barrage Fluffy_Pillow 22510.0/63371: 36% mana arcane_charge(4), rune_of_power
1:08.708 aoe o arcane_explosion Fluffy_Pillow 26701.4/63371: 42% mana rune_of_power
1:10.014 aoe o arcane_explosion Fluffy_Pillow 23356.6/63371: 37% mana arcane_charge, rune_of_power
1:11.319 aoe o arcane_explosion Fluffy_Pillow 20010.6/63371: 32% mana arcane_charge(2), rune_of_power
1:12.626 aoe o arcane_explosion Fluffy_Pillow 16667.2/63371: 26% mana arcane_charge(3), rune_of_power
1:13.932 aoe p arcane_barrage Fluffy_Pillow 13322.4/63371: 21% mana arcane_charge(4), clearcasting, rune_of_power
1:15.239 aoe n arcane_orb Fluffy_Pillow 17513.8/63371: 28% mana clearcasting, rune_of_power
1:16.545 aoe p arcane_barrage Fluffy_Pillow 18669.1/63371: 29% mana arcane_charge(4), clearcasting, rune_of_power
1:17.852 aoe o arcane_explosion Fluffy_Pillow 22860.5/63371: 36% mana clearcasting, rune_of_power
1:19.157 aoe o arcane_explosion Fluffy_Pillow 24514.5/63371: 39% mana arcane_charge, rune_of_power
1:20.462 aoe o arcane_explosion Fluffy_Pillow 21168.5/63371: 33% mana arcane_charge(2)
1:21.770 aoe o arcane_explosion Fluffy_Pillow 17826.2/63371: 28% mana arcane_charge(3)
1:23.076 aoe p arcane_barrage Fluffy_Pillow 14481.5/63371: 23% mana arcane_charge(4)
1:24.384 aoe o arcane_explosion Fluffy_Pillow 18674.2/63371: 29% mana
1:25.691 aoe o arcane_explosion Fluffy_Pillow 15330.7/63371: 24% mana arcane_charge
1:26.999 aoe o arcane_explosion Fluffy_Pillow 11988.5/63371: 19% mana arcane_charge(2), clearcasting
1:28.306 aoe o arcane_explosion Fluffy_Pillow 13645.0/63371: 22% mana arcane_charge(3)
1:29.613 aoe p arcane_barrage Fluffy_Pillow 10301.5/63371: 16% mana arcane_charge(4)
1:30.919 aoe o arcane_explosion Fluffy_Pillow 14491.7/63371: 23% mana
1:32.225 aoe o arcane_explosion Fluffy_Pillow 11146.9/63371: 18% mana arcane_charge
1:33.534 aoe o arcane_explosion Fluffy_Pillow 7806.0/63371: 12% mana arcane_charge(2)
1:34.842 aoe q evocation Venthyr_Theotar 4463.8/63371: 7% mana arcane_charge(3)
1:39.187 aoe o arcane_explosion Fluffy_Pillow 58309.7/63371: 92% mana arcane_charge(3)
1:40.493 aoe p arcane_barrage Fluffy_Pillow 54965.0/63371: 87% mana arcane_charge(4)
1:41.801 aoe n arcane_orb Fluffy_Pillow 59157.6/63371: 93% mana
1:43.106 aoe p arcane_barrage Fluffy_Pillow 60311.6/63371: 95% mana arcane_charge(4)
1:44.411 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
1:45.720 aoe o arcane_explosion Fluffy_Pillow 60030.5/63371: 95% mana arcane_charge
1:47.027 aoe o arcane_explosion Fluffy_Pillow 56687.0/63371: 89% mana arcane_charge(2), clearcasting
1:48.334 aoe o arcane_explosion Fluffy_Pillow 58343.6/63371: 92% mana arcane_charge(3)
1:49.640 aoe p arcane_barrage Fluffy_Pillow 54998.8/63371: 87% mana arcane_charge(4)
1:50.946 aoe o arcane_explosion Fluffy_Pillow 59188.9/63371: 93% mana
1:52.253 aoe k touch_of_the_magi Fluffy_Pillow 55845.5/63371: 88% mana arcane_charge, clearcasting
1:53.558 aoe m rune_of_power Fluffy_Pillow 54999.5/63371: 87% mana arcane_charge(4), clearcasting
1:54.863 aoe p arcane_barrage Fluffy_Pillow 56653.4/63371: 89% mana arcane_charge(4), clearcasting, rune_of_power
1:56.171 aoe o arcane_explosion Fluffy_Pillow 60846.1/63371: 96% mana clearcasting, rune_of_power
1:57.478 aoe o arcane_explosion Fluffy_Pillow 62502.6/63371: 99% mana arcane_charge, rune_of_power
1:58.784 aoe o arcane_explosion Fluffy_Pillow 59157.9/63371: 93% mana arcane_charge(2), rune_of_power
2:00.092 aoe o arcane_explosion Fluffy_Pillow 55815.7/63371: 88% mana arcane_charge(3), clearcasting, rune_of_power
2:01.397 aoe p arcane_barrage Fluffy_Pillow 57469.7/63371: 91% mana arcane_charge(4), rune_of_power
2:02.703 aoe n arcane_orb Fluffy_Pillow 61659.8/63371: 97% mana rune_of_power
2:04.010 aoe p arcane_barrage Fluffy_Pillow 62816.3/63371: 99% mana arcane_charge(4), rune_of_power
2:05.315 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:06.621 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power
2:07.927 aoe o arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), clearcasting
2:09.232 aoe o arcane_explosion Fluffy_Pillow 58335.9/63371: 92% mana arcane_charge(3)
2:10.540 aoe l arcane_power Fluffy_Pillow 54993.7/63371: 87% mana arcane_charge(4), clearcasting
2:10.540 aoe p arcane_barrage Fluffy_Pillow 54993.7/63371: 87% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
2:11.846 aoe o arcane_explosion Fluffy_Pillow 59183.9/63371: 93% mana arcane_power, clearcasting, rune_of_power
2:13.152 aoe o arcane_explosion Fluffy_Pillow 60839.1/63371: 96% mana arcane_charge, arcane_power, rune_of_power
2:14.458 aoe o arcane_explosion Fluffy_Pillow 59994.4/63371: 95% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power
2:15.765 aoe o arcane_explosion Fluffy_Pillow 61650.9/63371: 97% mana arcane_charge(3), arcane_power, rune_of_power
2:17.072 aoe p arcane_barrage Fluffy_Pillow 60807.4/63371: 96% mana arcane_charge(4), arcane_power, rune_of_power
2:18.379 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, rune_of_power
2:19.684 aoe o arcane_explosion Fluffy_Pillow 62525.4/63371: 99% mana arcane_charge, arcane_power, rune_of_power
2:20.991 aoe o arcane_explosion Fluffy_Pillow 61682.0/63371: 97% mana arcane_charge(2), arcane_power, rune_of_power
2:22.298 aoe o arcane_explosion Fluffy_Pillow 60838.5/63371: 96% mana arcane_charge(3), arcane_power, rune_of_power
2:23.605 aoe p arcane_barrage Fluffy_Pillow 59995.0/63371: 95% mana arcane_charge(4), arcane_power, clearcasting
2:24.912 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, clearcasting
2:26.219 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), clearcasting
2:27.526 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting
2:28.833 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge
2:30.141 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge(2)
2:31.449 aoe o arcane_explosion Fluffy_Pillow 56687.0/63371: 89% mana arcane_charge(3)
2:32.755 shared_cds r use_mana_gem Venthyr_Theotar 53342.3/63371: 84% mana arcane_charge(4)
2:32.755 aoe p arcane_barrage Fluffy_Pillow 59679.4/63371: 94% mana arcane_charge(4)
2:34.063 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana soothing_shade
2:35.368 aoe o arcane_explosion Fluffy_Pillow 69260.3/72371: 96% mana arcane_charge, soothing_shade
2:36.675 aoe o arcane_explosion Fluffy_Pillow 66152.1/72371: 91% mana arcane_charge(2), soothing_shade
2:37.980 aoe o arcane_explosion Fluffy_Pillow 63041.0/72371: 87% mana arcane_charge(3), soothing_shade
2:39.287 aoe p arcane_barrage Fluffy_Pillow 59932.8/72371: 83% mana arcane_charge(4), soothing_shade
2:40.594 aoe j mirrors_of_torment Fluffy_Pillow 64719.4/72371: 89% mana soothing_shade
2:41.901 aoe k touch_of_the_magi Fluffy_Pillow 64611.2/72371: 89% mana soothing_shade
2:43.209 aoe m rune_of_power Fluffy_Pillow 64004.5/72371: 88% mana arcane_charge(4), soothing_shade
2:44.513 aoe p arcane_barrage Fluffy_Pillow 68786.8/72371: 95% mana arcane_charge(4), rune_of_power, soothing_shade
2:45.820 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:47.125 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power
2:48.430 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:49.736 aoe o arcane_explosion Fluffy_Pillow 62561.5/63371: 99% mana arcane_charge, rune_of_power
2:51.044 aoe o arcane_explosion Fluffy_Pillow 59219.3/63371: 93% mana arcane_charge(2), rune_of_power
2:52.352 aoe o arcane_explosion Fluffy_Pillow 55877.1/63371: 88% mana arcane_charge(3), rune_of_power
2:53.657 aoe p arcane_barrage Fluffy_Pillow 52531.1/63371: 83% mana arcane_charge(4), clearcasting, rune_of_power
2:54.963 aoe o arcane_explosion Fluffy_Pillow 56721.3/63371: 90% mana clearcasting, rune_of_power
2:56.268 aoe o arcane_explosion Fluffy_Pillow 60910.1/63371: 96% mana arcane_charge, rune_of_power
2:57.574 aoe o arcane_explosion Fluffy_Pillow 65740.8/72371: 91% mana arcane_charge(2), clearcasting, soothing_shade
2:58.880 aoe o arcane_explosion Fluffy_Pillow 67631.1/72371: 93% mana arcane_charge(3), soothing_shade
3:00.185 aoe p arcane_barrage Fluffy_Pillow 64520.0/72371: 89% mana arcane_charge(4), soothing_shade
3:01.493 aoe o arcane_explosion Fluffy_Pillow 69308.1/72371: 96% mana soothing_shade
3:02.799 aoe o arcane_explosion Fluffy_Pillow 66198.5/72371: 91% mana arcane_charge, soothing_shade
3:04.105 aoe o arcane_explosion Fluffy_Pillow 63088.8/72371: 87% mana arcane_charge(2), soothing_shade
3:05.410 aoe o arcane_explosion Fluffy_Pillow 59977.7/72371: 83% mana arcane_charge(3), soothing_shade
3:06.715 aoe p arcane_barrage Fluffy_Pillow 56866.6/72371: 79% mana arcane_charge(4), soothing_shade
3:08.021 aoe n arcane_orb Fluffy_Pillow 61651.8/72371: 85% mana soothing_shade
3:09.328 aoe p arcane_barrage Fluffy_Pillow 55203.6/63371: 87% mana arcane_charge(4)
3:10.633 aoe o arcane_explosion Fluffy_Pillow 59392.4/63371: 94% mana
3:11.939 aoe o arcane_explosion Fluffy_Pillow 56047.7/63371: 88% mana arcane_charge
3:13.246 aoe o arcane_explosion Fluffy_Pillow 52704.2/63371: 83% mana arcane_charge(2), clearcasting
3:14.553 aoe o arcane_explosion Fluffy_Pillow 54360.7/63371: 86% mana arcane_charge(3)
3:15.861 aoe p arcane_barrage Fluffy_Pillow 51018.5/63371: 81% mana arcane_charge(4), clearcasting
3:17.166 aoe o arcane_explosion Fluffy_Pillow 55207.4/63371: 87% mana clearcasting
3:18.473 aoe o arcane_explosion Fluffy_Pillow 56863.9/63371: 90% mana arcane_charge
3:19.781 aoe o arcane_explosion Fluffy_Pillow 53521.7/63371: 84% mana arcane_charge(2)
3:21.085 aoe o arcane_explosion Fluffy_Pillow 50174.4/63371: 79% mana arcane_charge(3)
3:22.391 aoe p arcane_barrage Fluffy_Pillow 46829.7/63371: 74% mana arcane_charge(4), clearcasting
3:23.697 aoe o arcane_explosion Fluffy_Pillow 51019.8/63371: 81% mana clearcasting
3:25.004 aoe o arcane_explosion Fluffy_Pillow 52676.4/63371: 83% mana arcane_charge
3:26.310 aoe o arcane_explosion Fluffy_Pillow 49331.6/63371: 78% mana arcane_charge(2)
3:27.617 aoe o arcane_explosion Fluffy_Pillow 45988.2/63371: 73% mana arcane_charge(3)
3:28.922 aoe p arcane_barrage Fluffy_Pillow 42642.1/63371: 67% mana arcane_charge(4)
3:30.229 aoe k touch_of_the_magi Fluffy_Pillow 46833.5/63371: 74% mana
3:31.536 aoe m rune_of_power Fluffy_Pillow 45990.1/63371: 73% mana arcane_charge(4)
3:32.845 aoe p arcane_barrage Fluffy_Pillow 47649.1/63371: 75% mana arcane_charge(4), rune_of_power
3:34.151 aoe n arcane_orb Fluffy_Pillow 51839.2/63371: 82% mana rune_of_power
3:35.459 aoe p arcane_barrage Fluffy_Pillow 52997.0/63371: 84% mana arcane_charge(4), rune_of_power
3:36.767 aoe o arcane_explosion Fluffy_Pillow 57189.7/63371: 90% mana rune_of_power
3:38.073 aoe o arcane_explosion Fluffy_Pillow 53845.0/63371: 85% mana arcane_charge, clearcasting, rune_of_power
3:39.378 aoe o arcane_explosion Fluffy_Pillow 55498.9/63371: 88% mana arcane_charge(2), rune_of_power
3:40.684 aoe o arcane_explosion Fluffy_Pillow 52154.2/63371: 82% mana arcane_charge(3), clearcasting, rune_of_power
3:41.990 aoe p arcane_barrage Fluffy_Pillow 53809.5/63371: 85% mana arcane_charge(4), rune_of_power
3:43.296 aoe o arcane_explosion Fluffy_Pillow 57999.6/63371: 92% mana rune_of_power
3:44.601 aoe o arcane_explosion Fluffy_Pillow 54653.6/63371: 86% mana arcane_charge, clearcasting, rune_of_power
3:45.909 aoe o arcane_explosion Fluffy_Pillow 56311.4/63371: 89% mana arcane_charge(2)
3:47.215 aoe o arcane_explosion Fluffy_Pillow 52966.6/63371: 84% mana arcane_charge(3)
3:48.523 aoe p arcane_barrage Fluffy_Pillow 49624.4/63371: 78% mana arcane_charge(4)
3:49.831 aoe o arcane_explosion Fluffy_Pillow 53817.1/63371: 85% mana
3:51.137 aoe o arcane_explosion Fluffy_Pillow 50472.4/63371: 80% mana arcane_charge, clearcasting
3:52.442 aoe o arcane_explosion Fluffy_Pillow 52126.4/63371: 82% mana arcane_charge(2)
3:53.748 aoe o arcane_explosion Fluffy_Pillow 48781.6/63371: 77% mana arcane_charge(3)
3:55.055 aoe p arcane_barrage Fluffy_Pillow 45438.1/63371: 72% mana arcane_charge(4)
3:56.362 aoe n arcane_orb Fluffy_Pillow 49629.5/63371: 78% mana
3:57.669 aoe p arcane_barrage Fluffy_Pillow 50786.1/63371: 80% mana arcane_charge(4)
3:58.975 aoe o arcane_explosion Fluffy_Pillow 54976.2/63371: 87% mana
4:00.280 aoe o arcane_explosion Fluffy_Pillow 51630.2/63371: 81% mana arcane_charge
4:01.586 aoe o arcane_explosion Fluffy_Pillow 48285.4/63371: 76% mana arcane_charge(2)
4:02.892 aoe o arcane_explosion Fluffy_Pillow 44940.7/63371: 71% mana arcane_charge(3)
4:04.197 aoe p arcane_barrage Fluffy_Pillow 41594.7/63371: 66% mana arcane_charge(4)
4:05.503 aoe o arcane_explosion Fluffy_Pillow 45784.8/63371: 72% mana
4:06.810 aoe o arcane_explosion Fluffy_Pillow 42441.3/63371: 67% mana arcane_charge, clearcasting
4:08.116 aoe o arcane_explosion Fluffy_Pillow 44096.6/63371: 70% mana arcane_charge(2)
4:09.424 aoe o arcane_explosion Fluffy_Pillow 40754.4/63371: 64% mana arcane_charge(3)
4:10.730 aoe p arcane_barrage Fluffy_Pillow 37409.7/63371: 59% mana arcane_charge(4)
4:12.036 aoe o arcane_explosion Fluffy_Pillow 41599.8/63371: 66% mana
4:13.343 aoe o arcane_explosion Fluffy_Pillow 38256.3/63371: 60% mana arcane_charge
4:14.648 aoe o arcane_explosion Fluffy_Pillow 34910.3/63371: 55% mana arcane_charge(2)
4:15.954 aoe o arcane_explosion Fluffy_Pillow 31565.6/63371: 50% mana arcane_charge(3)
4:17.261 aoe p arcane_barrage Fluffy_Pillow 28222.1/63371: 45% mana arcane_charge(4)
4:18.568 aoe j mirrors_of_torment Fluffy_Pillow 32413.5/63371: 51% mana
4:19.874 aoe k touch_of_the_magi Fluffy_Pillow 32068.7/63371: 51% mana
4:21.181 aoe l arcane_power Fluffy_Pillow 31225.3/63371: 49% mana arcane_charge(4)
4:21.181 shared_cds t berserking Fluffy_Pillow 31225.3/63371: 49% mana arcane_charge(4), arcane_power, rune_of_power
4:21.181 aoe p arcane_barrage Fluffy_Pillow 31225.3/63371: 49% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:22.368 aoe n arcane_orb Fluffy_Pillow 37799.4/63371: 60% mana berserking, arcane_power, rune_of_power
4:23.558 aoe p arcane_barrage Fluffy_Pillow 39057.7/63371: 62% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:24.745 aoe o arcane_explosion Fluffy_Pillow 43097.0/63371: 68% mana berserking, arcane_power, rune_of_power
4:25.933 aoe o arcane_explosion Fluffy_Pillow 42102.7/63371: 66% mana berserking, arcane_charge, arcane_power, rune_of_power
4:27.123 aoe o arcane_explosion Fluffy_Pillow 41110.9/63371: 65% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:28.312 aoe o arcane_explosion Fluffy_Pillow 42652.7/63371: 67% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:29.501 aoe p arcane_barrage Fluffy_Pillow 41659.7/63371: 66% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:30.689 aoe o arcane_explosion Fluffy_Pillow 45700.3/63371: 72% mana berserking, arcane_power, rune_of_power
4:31.878 aoe o arcane_explosion Fluffy_Pillow 44707.2/63371: 71% mana berserking, arcane_charge, arcane_power, rune_of_power
4:33.065 shared_cds r use_mana_gem Venthyr_Theotar 43711.7/63371: 69% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:33.065 aoe o arcane_explosion Fluffy_Pillow 50048.8/63371: 79% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:34.255 aoe o arcane_explosion Fluffy_Pillow 51591.9/63371: 81% mana arcane_charge(3), arcane_power
4:35.562 aoe m rune_of_power Fluffy_Pillow 50748.4/63371: 80% mana arcane_charge(4), arcane_power, clearcasting
4:36.870 aoe p arcane_barrage Fluffy_Pillow 52406.2/63371: 83% mana arcane_charge(4), clearcasting, rune_of_power
4:38.177 aoe o arcane_explosion Fluffy_Pillow 56597.6/63371: 89% mana clearcasting, rune_of_power
4:39.483 aoe o arcane_explosion Fluffy_Pillow 58252.9/63371: 92% mana arcane_charge, rune_of_power
4:40.790 aoe o arcane_explosion Fluffy_Pillow 54909.4/63371: 87% mana arcane_charge(2), clearcasting, rune_of_power
4:42.097 aoe o arcane_explosion Fluffy_Pillow 56565.9/63371: 89% mana arcane_charge(3), rune_of_power
4:43.405 aoe p arcane_barrage Fluffy_Pillow 53223.7/63371: 84% mana arcane_charge(4), rune_of_power
4:44.710 aoe n arcane_orb Fluffy_Pillow 57412.6/63371: 91% mana rune_of_power
4:46.018 aoe p arcane_barrage Fluffy_Pillow 58570.4/63371: 92% mana arcane_charge(4), rune_of_power
4:47.325 aoe o arcane_explosion Fluffy_Pillow 62761.8/63371: 99% mana rune_of_power
4:48.633 aoe o arcane_explosion Fluffy_Pillow 59419.6/63371: 94% mana arcane_charge, clearcasting, rune_of_power
4:49.937 aoe o arcane_explosion Fluffy_Pillow 61072.3/63371: 96% mana arcane_charge(2)
4:51.244 aoe o arcane_explosion Fluffy_Pillow 57728.8/63371: 91% mana arcane_charge(3)
4:52.552 aoe p arcane_barrage Fluffy_Pillow 54386.6/63371: 86% mana arcane_charge(4)
4:53.858 aoe o arcane_explosion Fluffy_Pillow 58576.7/63371: 92% mana
4:55.165 aoe o arcane_explosion Fluffy_Pillow 55233.3/63371: 87% mana arcane_charge
4:56.471 aoe o arcane_explosion Fluffy_Pillow 51888.5/63371: 82% mana arcane_charge(2)
4:57.778 aoe o arcane_explosion Fluffy_Pillow 48545.1/63371: 77% mana arcane_charge(3)
4:59.083 aoe p arcane_barrage Fluffy_Pillow 45199.1/63371: 71% mana arcane_charge(4)
5:00.387 aoe o arcane_explosion Fluffy_Pillow 49386.6/63371: 78% mana
5:01.694 aoe o arcane_explosion Fluffy_Pillow 46043.2/63371: 73% mana arcane_charge
5:03.000 aoe o arcane_explosion Fluffy_Pillow 42698.4/63371: 67% mana arcane_charge(2), clearcasting
5:04.306 aoe o arcane_explosion Fluffy_Pillow 44353.7/63371: 70% mana arcane_charge(3)
5:05.614 aoe p arcane_barrage Fluffy_Pillow 41011.5/63371: 65% mana arcane_charge(4), clearcasting
5:06.921 aoe n arcane_orb Fluffy_Pillow 45202.9/63371: 71% mana clearcasting
5:08.229 aoe p arcane_barrage Fluffy_Pillow 46360.7/63371: 73% mana arcane_charge(4), clearcasting
5:09.535 aoe o arcane_explosion Fluffy_Pillow 50550.8/63371: 80% mana clearcasting
5:10.842 aoe o arcane_explosion Fluffy_Pillow 52207.3/63371: 82% mana arcane_charge
5:12.148 aoe o arcane_explosion Fluffy_Pillow 48862.6/63371: 77% mana arcane_charge(2)
5:13.454 aoe o arcane_explosion Fluffy_Pillow 45517.8/63371: 72% mana arcane_charge(3)
5:14.762 aoe p arcane_barrage Fluffy_Pillow 42175.6/63371: 67% mana arcane_charge(4)
5:16.069 aoe o arcane_explosion Fluffy_Pillow 52952.1/72371: 73% mana soothing_shade
5:17.376 aoe o arcane_explosion Fluffy_Pillow 49843.9/72371: 69% mana arcane_charge, soothing_shade
5:18.684 aoe o arcane_explosion Fluffy_Pillow 46737.1/72371: 65% mana arcane_charge(2), clearcasting, soothing_shade
5:19.990 aoe o arcane_explosion Fluffy_Pillow 48627.4/72371: 67% mana arcane_charge(3), soothing_shade
5:21.296 aoe p arcane_barrage Fluffy_Pillow 45517.8/72371: 63% mana arcane_charge(4), soothing_shade
5:22.601 aoe k touch_of_the_magi Fluffy_Pillow 50301.5/72371: 70% mana soothing_shade
5:23.907 aoe m rune_of_power Fluffy_Pillow 49691.9/72371: 69% mana arcane_charge(4), soothing_shade
5:25.214 aoe p arcane_barrage Fluffy_Pillow 51583.7/72371: 71% mana arcane_charge(4), rune_of_power, soothing_shade
5:26.521 aoe o arcane_explosion Fluffy_Pillow 56370.3/72371: 78% mana rune_of_power, soothing_shade
5:27.828 aoe o arcane_explosion Fluffy_Pillow 46638.5/63371: 74% mana arcane_charge, clearcasting, rune_of_power
5:29.135 aoe o arcane_explosion Fluffy_Pillow 48295.0/63371: 76% mana arcane_charge(2), rune_of_power
5:30.441 aoe o arcane_explosion Fluffy_Pillow 44950.3/63371: 71% mana arcane_charge(3), clearcasting, rune_of_power
5:31.748 aoe p arcane_barrage Fluffy_Pillow 46606.8/63371: 74% mana arcane_charge(4), rune_of_power
5:33.055 aoe n arcane_orb Fluffy_Pillow 50798.2/63371: 80% mana rune_of_power
5:34.363 aoe p arcane_barrage Fluffy_Pillow 51956.0/63371: 82% mana arcane_charge(4), rune_of_power
5:35.671 aoe o arcane_explosion Fluffy_Pillow 56148.7/63371: 89% mana rune_of_power
5:36.977 aoe o arcane_explosion Fluffy_Pillow 52803.9/63371: 83% mana arcane_charge, clearcasting, rune_of_power
5:38.284 aoe o arcane_explosion Fluffy_Pillow 54460.4/63371: 86% mana arcane_charge(2)
5:39.590 aoe o arcane_explosion Fluffy_Pillow 51115.7/63371: 81% mana arcane_charge(3)
5:40.898 aoe p arcane_barrage Fluffy_Pillow 47773.5/63371: 75% mana arcane_charge(4)
5:42.206 aoe o arcane_explosion Fluffy_Pillow 51966.2/63371: 82% mana
5:43.513 aoe o arcane_explosion Fluffy_Pillow 48622.7/63371: 77% mana arcane_charge
5:44.818 aoe o arcane_explosion Fluffy_Pillow 45276.7/63371: 71% mana arcane_charge(2), clearcasting
5:46.125 aoe o arcane_explosion Fluffy_Pillow 46933.2/63371: 74% mana arcane_charge(3)
5:47.432 aoe p arcane_barrage Fluffy_Pillow 43589.7/63371: 69% mana arcane_charge(4)
5:48.739 aoe o arcane_explosion Fluffy_Pillow 47781.1/63371: 75% mana
5:50.047 aoe o arcane_explosion Fluffy_Pillow 44438.9/63371: 70% mana arcane_charge
5:51.354 aoe o arcane_explosion Fluffy_Pillow 41095.5/63371: 65% mana arcane_charge(2)
5:52.662 aoe o arcane_explosion Fluffy_Pillow 37753.2/63371: 60% mana arcane_charge(3)
5:53.970 aoe p arcane_barrage Fluffy_Pillow 34411.0/63371: 54% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Theotar"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=336239//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

arcane : 10176 dps, 4330 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10175.7 10175.7 15.6 / 0.153% 1075.0 / 10.6% 5.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
2049.5 1946.7 Mana 0.00% 49.4 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 10176
Arcane Barrage 3918 38.5% 57.3 5.26sec 20538 16527 Direct 171.6 5735 11499 6856 19.5%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.26 171.56 0.00 0.00 1.2427 0.0000 1176052.02 1176052.02 0.00% 16526.87 16526.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 138.18 103 174 5734.75 2082 25140 5730.42 5004 6453 792270 792270 0.00%
crit 19.46% 33.38 15 53 11499.48 4164 50280 11490.53 7836 16014 383782 383782 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:57.26
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [q]:0.00
Arcane Echo 234 2.3% 37.0 7.66sec 1901 0 Direct 110.9 531 1061 634 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.96 110.88 0.00 0.00 0.0000 0.0000 70264.25 70264.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 89.43 59 116 531.23 443 664 530.66 495 556 47499 47499 0.00%
crit 19.35% 21.46 8 38 1061.27 886 1329 1060.35 886 1218 22766 22766 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4589 45.1% 154.8 1.92sec 8892 7156 Direct 464.4 2486 4973 2964 19.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.79 464.36 0.00 0.00 1.2427 0.0000 1376406.68 1376406.68 0.00% 7155.89 7155.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 375.02 288 470 2485.86 1958 4112 2485.58 2383 2581 932111 932111 0.00%
crit 19.24% 89.34 51 130 4973.31 3916 8223 4972.74 4474 5550 444295 444295 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:154.79
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (820) 0.0% (8.1%) 13.1 23.63sec 18745 15033

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.11 0.00 0.00 0.00 1.2469 0.0000 0.00 0.00 0.00% 15033.15 15033.15

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.11
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 820 8.1% 39.3 23.63sec 6258 0 Direct 39.3 5252 10484 6260 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.27 39.27 0.00 0.00 0.0000 0.0000 245731.86 245731.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 31.70 22 44 5251.93 3869 8126 5252.93 4607 5901 166444 166444 0.00%
crit 19.28% 7.57 1 15 10483.65 7739 16251 10474.84 7739 14084 79288 79288 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.7%) 14.4 1.73sec 1386 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.41 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.7% 14.4 1.73sec 1386 0 Direct 14.4 1164 2327 1386 19.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.41 14.41 0.00 0.00 0.0000 0.0000 19970.29 19970.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.92% 11.66 4 19 1163.53 1164 1164 1163.53 1164 1164 13570 13570 0.00%
crit 19.08% 2.75 0 8 2327.06 2327 2327 2202.77 0 2327 6400 6400 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1754 18.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1758.08 1758.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.27% 0.81 0 1 1480.68 1481 1481 1203.28 0 1481 1203 1203 0.00%
crit 18.73% 0.19 0 1 2961.35 2961 2961 554.80 0 2961 555 555 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5791 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.2% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5790.58 5790.58 0.00% 49.16 49.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 72.62 59 85 53.94 43 60 53.94 52 55 3917 3917 0.00%
crit 19.31% 17.38 5 31 107.79 86 120 107.83 96 118 1874 1874 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (521) 0.0% (5.1%) 6.2 52.18sec 25307 19371

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.18 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 19371.34 19371.34

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.20
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 521 5.1% 6.2 52.10sec 25307 0 Direct 18.5 8464 0 8464 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.18 18.48 0.00 0.00 0.0000 0.0000 156268.60 156268.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.48 15 21 8464.29 2035 36533 8449.18 5944 11614 156269 156269 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11896.22
  • base_dd_max:11896.22
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.8 128.37sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 256.62sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 170.12sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.19 0.00 7.11 0.00 4.3219 0.7226 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.19
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 50.24sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.03 0.00 0.00 0.00 1.2568 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.05
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 124.36sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.0 155.3 5.2sec 1.4sec 3.8sec 73.99% 0.00% 0.8 (0.9) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.3s
  • trigger_min/max:0.0s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.10%
  • arcane_charge_2:16.48%
  • arcane_charge_3:16.83%
  • arcane_charge_4:21.59%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.4sec 128.4sec 14.7sec 13.90% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.8s / 133.7s
  • trigger_min/max:120.8s / 133.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.0s

Stack Uptimes

  • arcane_power_1:13.90%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 256.7sec 256.7sec 11.7sec 7.12% 23.68% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.9s / 265.7s
  • trigger_min/max:253.9s / 265.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s

Stack Uptimes

  • berserking_1:7.12%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.5 0.1 11.9sec 11.8sec 1.9sec 15.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.55%
  • clearcasting_2:0.13%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.2 0.0 169.1sec 169.1sec 4.3sec 1.71% 0.00% 4.7 (4.7) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:111.5s / 260.9s
  • trigger_min/max:111.5s / 260.9s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 4.3s

Stack Uptimes

  • evocation_1:1.71%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 34.89% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 52.7s
  • trigger_min/max:13.5s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.89%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.1sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.9s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.59%
Arcane Barrage Arcane Charge 4 100.00% 98.41% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.08% 0.77% 6.39% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.1s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.091120.122239.871
Evocation137.97321.476343.096210.119121.739353.676
Rune of Power6.1551.14020.77238.48123.99452.216
Touch of the Magi4.9100.00020.77331.79022.39050.611
Arcane Power5.9120.76213.68717.0647.92827.003
Arcane Barrage2.7460.0028.280158.375126.311192.309
Arcane Orb3.5240.01210.48646.51333.73761.175

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 491.96 370159.12 63.36% 752.42 9544.68 2.51%
Evocation Mana 56.98 57274.05 9.80% 1005.19 0.00 0.00%
Mana Gem Mana 2.73 17310.22 2.96% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.26 139447.11 23.87% 2435.35 5697.11 3.93%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1946.73 2049.52 15225.9 32524.3 337.9 63371.4
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 154.8 592777.8 3829.5 3829.7 2.3
arcane_orb Mana 13.1 5867.2 447.6 447.6 41.9
touch_of_the_magi Mana 6.2 15431.9 2500.0 2499.1 10.1

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
arcane Damage Per Second
Count 1217
Mean 10175.69
Minimum 9423.30
Maximum 10971.07
Spread ( max - min ) 1547.78
Range [ ( max - min ) / 2 * 100% ] 7.61%
Standard Deviation 276.7923
5th Percentile 9736.93
95th Percentile 10661.38
( 95th Percentile - 5th Percentile ) 924.45
Mean Distribution
Standard Deviation 7.9343
95.00% Confidence Interval ( 10160.14 - 10191.24 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2843
0.1 Scale Factor Error with Delta=300 655
0.05 Scale Factor Error with Delta=300 2617
0.01 Scale Factor Error with Delta=300 65403
Priority Target DPS
arcane Priority Target Damage Per Second
Count 1217
Mean 4330.07
Minimum 3845.74
Maximum 4884.51
Spread ( max - min ) 1038.78
Range [ ( max - min ) / 2 * 100% ] 11.99%
Standard Deviation 162.9674
5th Percentile 4078.16
95th Percentile 4610.11
( 95th Percentile - 5th Percentile ) 531.95
Mean Distribution
Standard Deviation 4.6715
95.00% Confidence Interval ( 4320.92 - 4339.23 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5442
0.1 Scale Factor Error with Delta=300 227
0.05 Scale Factor Error with Delta=300 907
0.01 Scale Factor Error with Delta=300 22672
DPS(e)
arcane Damage Per Second (Effective)
Count 1217
Mean 10175.69
Minimum 9423.30
Maximum 10971.07
Spread ( max - min ) 1547.78
Range [ ( max - min ) / 2 * 100% ] 7.61%
Damage
arcane Damage
Count 1217
Mean 3046451.77
Minimum 2335173.77
Maximum 3678402.83
Spread ( max - min ) 1343229.06
Range [ ( max - min ) / 2 * 100% ] 22.05%
DTPS
arcane Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.20 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.05 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.11 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 154.79 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 57.26 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.19 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkstomonnnnonnnnonnnnlonnnrnomonnnnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnpnonjlonnnnomonnnnkonnnnonnnnomonnnnonnrnnojlonnnnomonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnnnojktonnnnomonnnnlonrnnnonnnnomonnnnonnnnonnnpnomonjlonnnnonnnnomonnnnonnnnonnnn

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask arcane 63371.4/63371: 100% mana
Pre precombat R food arcane 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), clearcasting
0:01.307 shared_cds s potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power
0:01.307 shared_cds t berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:01.307 aoe o arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:02.221 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:03.136 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.050 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.965 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.880 aoe n arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.793 aoe n arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.708 aoe o arcane_barrage Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.621 aoe n arcane_explosion Fluffy_Pillow 63040.0/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.536 aoe n arcane_explosion Fluffy_Pillow 61699.7/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.451 aoe n arcane_explosion Fluffy_Pillow 60359.4/63371: 95% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.366 aoe n arcane_explosion Fluffy_Pillow 59019.1/63371: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.280 aoe o arcane_barrage Fluffy_Pillow 57677.5/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.195 aoe n arcane_explosion Fluffy_Pillow 61372.1/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.110 aoe n arcane_explosion Fluffy_Pillow 60031.8/63371: 95% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:15.115 aoe n arcane_explosion Fluffy_Pillow 58805.5/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.122 aoe n arcane_explosion Fluffy_Pillow 57581.8/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.129 aoe l rune_of_power Fluffy_Pillow 56358.1/63371: 89% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.135 aoe o arcane_barrage Fluffy_Pillow 57633.2/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.142 aoe n arcane_explosion Fluffy_Pillow 61444.3/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.148 aoe n arcane_explosion Fluffy_Pillow 57719.4/63371: 91% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.157 aoe n arcane_explosion Fluffy_Pillow 53998.2/63371: 85% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.163 shared_cds r use_mana_gem arcane 50273.2/63371: 79% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:22.163 aoe n arcane_explosion Fluffy_Pillow 56610.4/63371: 89% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.170 aoe o arcane_barrage Fluffy_Pillow 52886.7/63371: 83% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.178 aoe m arcane_orb Fluffy_Pillow 56699.1/63371: 89% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.184 aoe o arcane_barrage Fluffy_Pillow 57474.1/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.189 aoe n arcane_explosion Fluffy_Pillow 61282.8/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.195 aoe n arcane_explosion Fluffy_Pillow 57557.8/63371: 91% mana bloodlust, arcane_charge, rune_of_power
0:28.201 aoe n arcane_explosion Fluffy_Pillow 53832.8/63371: 85% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:29.208 aoe n arcane_explosion Fluffy_Pillow 55109.1/63371: 87% mana bloodlust, arcane_charge(3), rune_of_power
0:30.214 aoe o arcane_barrage Fluffy_Pillow 51384.2/63371: 81% mana bloodlust, arcane_charge(4), clearcasting
0:31.221 aoe n arcane_explosion Fluffy_Pillow 55195.3/63371: 87% mana bloodlust, clearcasting
0:32.229 aoe n arcane_explosion Fluffy_Pillow 56472.9/63371: 89% mana bloodlust, arcane_charge
0:33.235 aoe n arcane_explosion Fluffy_Pillow 52747.9/63371: 83% mana bloodlust, arcane_charge(2), clearcasting
0:34.241 aoe n arcane_explosion Fluffy_Pillow 54023.0/63371: 85% mana bloodlust, arcane_charge(3)
0:35.248 aoe o arcane_barrage Fluffy_Pillow 50299.3/63371: 79% mana bloodlust, arcane_charge(4)
0:36.254 aoe n arcane_explosion Fluffy_Pillow 54109.1/63371: 85% mana bloodlust
0:37.261 aoe n arcane_explosion Fluffy_Pillow 50385.4/63371: 80% mana bloodlust, arcane_charge
0:38.266 aoe n arcane_explosion Fluffy_Pillow 46659.2/63371: 74% mana bloodlust, arcane_charge(2)
0:39.274 aoe n arcane_explosion Fluffy_Pillow 42936.8/63371: 68% mana bloodlust, arcane_charge(3)
0:40.281 aoe o arcane_barrage Fluffy_Pillow 39213.1/63371: 62% mana bloodlust, arcane_charge(4)
0:41.286 aoe n arcane_explosion Fluffy_Pillow 43021.7/63371: 68% mana
0:42.592 aoe n arcane_explosion Fluffy_Pillow 39677.0/63371: 63% mana arcane_charge, clearcasting
0:43.899 aoe n arcane_explosion Fluffy_Pillow 41333.5/63371: 65% mana arcane_charge(2)
0:45.205 aoe n arcane_explosion Fluffy_Pillow 37988.8/63371: 60% mana arcane_charge(3)
0:46.511 aoe o arcane_barrage Fluffy_Pillow 34644.0/63371: 55% mana arcane_charge(4)
0:47.819 aoe m arcane_orb Fluffy_Pillow 38836.7/63371: 61% mana
0:49.127 aoe o arcane_barrage Fluffy_Pillow 39994.5/63371: 63% mana arcane_charge(4)
0:50.433 aoe n arcane_explosion Fluffy_Pillow 44184.6/63371: 70% mana
0:51.739 aoe n arcane_explosion Fluffy_Pillow 40839.8/63371: 64% mana arcane_charge
0:53.044 aoe n arcane_explosion Fluffy_Pillow 37493.8/63371: 59% mana arcane_charge(2)
0:54.348 aoe n arcane_explosion Fluffy_Pillow 34146.6/63371: 54% mana arcane_charge(3)
0:55.656 aoe o arcane_barrage Fluffy_Pillow 30804.4/63371: 49% mana arcane_charge(4)
0:56.961 aoe n arcane_explosion Fluffy_Pillow 34993.2/63371: 55% mana
0:58.267 aoe n arcane_explosion Fluffy_Pillow 31648.5/63371: 50% mana arcane_charge
0:59.574 aoe n arcane_explosion Fluffy_Pillow 28305.0/63371: 45% mana arcane_charge(2), clearcasting
1:00.881 aoe n arcane_explosion Fluffy_Pillow 29961.5/63371: 47% mana arcane_charge(3)
1:02.187 aoe o arcane_barrage Fluffy_Pillow 26616.8/63371: 42% mana arcane_charge(4)
1:03.492 aoe j touch_of_the_magi Fluffy_Pillow 30805.6/63371: 49% mana
1:04.798 aoe l rune_of_power Fluffy_Pillow 29960.9/63371: 47% mana arcane_charge(4)
1:06.103 aoe o arcane_barrage Fluffy_Pillow 31614.9/63371: 50% mana arcane_charge(4), rune_of_power
1:07.409 aoe n arcane_explosion Fluffy_Pillow 35805.0/63371: 57% mana rune_of_power
1:08.717 aoe n arcane_explosion Fluffy_Pillow 32462.8/63371: 51% mana arcane_charge, rune_of_power
1:10.024 aoe n arcane_explosion Fluffy_Pillow 29119.3/63371: 46% mana arcane_charge(2), rune_of_power
1:11.330 aoe n arcane_explosion Fluffy_Pillow 25774.6/63371: 41% mana arcane_charge(3), rune_of_power
1:12.637 aoe o arcane_barrage Fluffy_Pillow 22431.1/63371: 35% mana arcane_charge(4), rune_of_power
1:13.943 aoe m arcane_orb Fluffy_Pillow 26621.3/63371: 42% mana rune_of_power
1:15.251 aoe o arcane_barrage Fluffy_Pillow 27779.1/63371: 44% mana arcane_charge(4), rune_of_power
1:16.557 aoe n arcane_explosion Fluffy_Pillow 31969.2/63371: 50% mana rune_of_power
1:17.865 aoe n arcane_explosion Fluffy_Pillow 28627.0/63371: 45% mana arcane_charge, rune_of_power
1:19.170 aoe n arcane_explosion Fluffy_Pillow 25281.0/63371: 40% mana arcane_charge(2)
1:20.477 aoe n arcane_explosion Fluffy_Pillow 21937.5/63371: 35% mana arcane_charge(3)
1:21.784 aoe o arcane_barrage Fluffy_Pillow 18594.0/63371: 29% mana arcane_charge(4)
1:23.091 aoe n arcane_explosion Fluffy_Pillow 22785.4/63371: 36% mana
1:24.397 aoe n arcane_explosion Fluffy_Pillow 19440.7/63371: 31% mana arcane_charge
1:25.703 aoe n arcane_explosion Fluffy_Pillow 16095.9/63371: 25% mana arcane_charge(2)
1:27.009 aoe n arcane_explosion Fluffy_Pillow 12751.2/63371: 20% mana arcane_charge(3)
1:28.316 aoe o arcane_barrage Fluffy_Pillow 9407.7/63371: 15% mana arcane_charge(4)
1:29.622 aoe n arcane_explosion Fluffy_Pillow 13597.8/63371: 21% mana
1:30.929 aoe n arcane_explosion Fluffy_Pillow 10254.4/63371: 16% mana arcane_charge, clearcasting
1:32.237 aoe n arcane_explosion Fluffy_Pillow 11912.2/63371: 19% mana arcane_charge(2)
1:33.543 aoe n arcane_explosion Fluffy_Pillow 8567.4/63371: 14% mana arcane_charge(3)
1:34.851 aoe o arcane_barrage Fluffy_Pillow 5225.2/63371: 8% mana arcane_charge(4)
1:36.157 aoe m arcane_orb Fluffy_Pillow 9415.3/63371: 15% mana
1:37.463 aoe o arcane_barrage Fluffy_Pillow 10570.6/63371: 17% mana arcane_charge(4)
1:38.768 aoe n arcane_explosion Fluffy_Pillow 14759.5/63371: 23% mana
1:40.076 aoe n arcane_explosion Fluffy_Pillow 11417.3/63371: 18% mana arcane_charge
1:41.380 aoe n arcane_explosion Fluffy_Pillow 8070.0/63371: 13% mana arcane_charge(2)
1:42.687 aoe p evocation arcane 4726.5/63371: 7% mana arcane_charge(3)
1:47.032 aoe n arcane_explosion Fluffy_Pillow 58572.4/63371: 92% mana arcane_charge(3)
1:48.338 aoe o arcane_barrage Fluffy_Pillow 55227.7/63371: 87% mana arcane_charge(4)
1:49.646 aoe n arcane_explosion Fluffy_Pillow 59420.4/63371: 94% mana
1:50.954 aoe j touch_of_the_magi Fluffy_Pillow 56078.2/63371: 88% mana arcane_charge
1:52.259 aoe l rune_of_power Fluffy_Pillow 55232.2/63371: 87% mana arcane_charge(4)
1:53.567 aoe o arcane_barrage Fluffy_Pillow 56889.9/63371: 90% mana arcane_charge(4), rune_of_power
1:54.873 aoe n arcane_explosion Fluffy_Pillow 61080.1/63371: 96% mana rune_of_power
1:56.180 aoe n arcane_explosion Fluffy_Pillow 57736.6/63371: 91% mana arcane_charge, rune_of_power
1:57.487 aoe n arcane_explosion Fluffy_Pillow 54393.1/63371: 86% mana arcane_charge(2), clearcasting, rune_of_power
1:58.792 aoe n arcane_explosion Fluffy_Pillow 56047.1/63371: 88% mana arcane_charge(3), rune_of_power
2:00.097 aoe o arcane_barrage Fluffy_Pillow 52701.1/63371: 83% mana arcane_charge(4), clearcasting, rune_of_power
2:01.403 aoe m arcane_orb Fluffy_Pillow 56891.2/63371: 90% mana clearcasting, rune_of_power
2:02.708 aoe o arcane_barrage Fluffy_Pillow 58045.2/63371: 92% mana arcane_charge(4), clearcasting, rune_of_power
2:04.014 aoe n arcane_explosion Fluffy_Pillow 62235.3/63371: 98% mana clearcasting, rune_of_power
2:05.319 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power
2:06.624 aoe n arcane_explosion Fluffy_Pillow 60025.4/63371: 95% mana arcane_charge(2)
2:07.930 aoe n arcane_explosion Fluffy_Pillow 56680.7/63371: 89% mana arcane_charge(3)
2:09.236 aoe k arcane_power Fluffy_Pillow 53335.9/63371: 84% mana arcane_charge(4)
2:09.236 aoe o arcane_barrage Fluffy_Pillow 53335.9/63371: 84% mana arcane_charge(4), arcane_power, rune_of_power
2:10.544 aoe n arcane_explosion Fluffy_Pillow 57528.6/63371: 91% mana arcane_power, rune_of_power
2:11.852 aoe n arcane_explosion Fluffy_Pillow 56686.4/63371: 89% mana arcane_charge, arcane_power, rune_of_power
2:13.158 aoe n arcane_explosion Fluffy_Pillow 55841.7/63371: 88% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power
2:14.467 aoe n arcane_explosion Fluffy_Pillow 57500.7/63371: 91% mana arcane_charge(3), arcane_power, rune_of_power
2:15.773 aoe o arcane_barrage Fluffy_Pillow 56656.0/63371: 89% mana arcane_charge(4), arcane_power, rune_of_power
2:17.080 aoe n arcane_explosion Fluffy_Pillow 60847.4/63371: 96% mana arcane_power, rune_of_power
2:18.383 aoe n arcane_explosion Fluffy_Pillow 59998.8/63371: 95% mana arcane_charge, arcane_power, rune_of_power
2:19.690 aoe n arcane_explosion Fluffy_Pillow 59155.4/63371: 93% mana arcane_charge(2), arcane_power, rune_of_power
2:20.997 aoe n arcane_explosion Fluffy_Pillow 58311.9/63371: 92% mana arcane_charge(3), arcane_power, rune_of_power
2:22.304 aoe o arcane_barrage Fluffy_Pillow 57468.4/63371: 91% mana arcane_charge(4), arcane_power
2:23.612 aoe m arcane_orb Fluffy_Pillow 61661.1/63371: 97% mana arcane_power
2:24.919 aoe o arcane_barrage Fluffy_Pillow 63067.6/63371: 100% mana arcane_charge(4)
2:26.227 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
2:27.534 aoe n arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, clearcasting
2:28.841 aoe n arcane_explosion Fluffy_Pillow 61684.5/63371: 97% mana arcane_charge(2)
2:30.148 aoe n arcane_explosion Fluffy_Pillow 58341.0/63371: 92% mana arcane_charge(3)
2:31.456 aoe o arcane_barrage Fluffy_Pillow 54998.8/63371: 87% mana arcane_charge(4)
2:32.763 aoe n arcane_explosion Fluffy_Pillow 59190.2/63371: 93% mana
2:34.069 aoe n arcane_explosion Fluffy_Pillow 55845.5/63371: 88% mana arcane_charge
2:35.374 shared_cds r use_mana_gem arcane 52499.5/63371: 83% mana arcane_charge(2)
2:35.374 aoe n arcane_explosion Fluffy_Pillow 58836.6/63371: 93% mana arcane_charge(2)
2:36.682 aoe n arcane_explosion Fluffy_Pillow 55494.4/63371: 88% mana arcane_charge(3)
2:37.991 aoe o arcane_barrage Fluffy_Pillow 52153.5/63371: 82% mana arcane_charge(4)
2:39.297 aoe j touch_of_the_magi Fluffy_Pillow 56343.6/63371: 89% mana
2:40.602 aoe l rune_of_power Fluffy_Pillow 55497.6/63371: 88% mana arcane_charge(4)
2:41.908 aoe o arcane_barrage Fluffy_Pillow 57152.8/63371: 90% mana arcane_charge(4), rune_of_power
2:43.213 aoe n arcane_explosion Fluffy_Pillow 61341.7/63371: 97% mana rune_of_power
2:44.518 aoe n arcane_explosion Fluffy_Pillow 57995.7/63371: 92% mana arcane_charge, rune_of_power
2:45.825 aoe n arcane_explosion Fluffy_Pillow 54652.2/63371: 86% mana arcane_charge(2), rune_of_power
2:47.129 aoe n arcane_explosion Fluffy_Pillow 51304.9/63371: 81% mana arcane_charge(3), rune_of_power
2:48.435 aoe o arcane_barrage Fluffy_Pillow 47960.2/63371: 76% mana arcane_charge(4), rune_of_power
2:49.741 aoe m arcane_orb Fluffy_Pillow 52150.3/63371: 82% mana rune_of_power
2:51.047 aoe o arcane_barrage Fluffy_Pillow 53305.6/63371: 84% mana arcane_charge(4), rune_of_power
2:52.353 aoe n arcane_explosion Fluffy_Pillow 57495.7/63371: 91% mana rune_of_power
2:53.659 aoe n arcane_explosion Fluffy_Pillow 54151.0/63371: 85% mana arcane_charge, rune_of_power
2:54.965 aoe n arcane_explosion Fluffy_Pillow 50806.2/63371: 80% mana arcane_charge(2)
2:56.273 aoe n arcane_explosion Fluffy_Pillow 47464.0/63371: 75% mana arcane_charge(3)
2:57.578 aoe o arcane_barrage Fluffy_Pillow 44118.0/63371: 70% mana arcane_charge(4)
2:58.884 aoe n arcane_explosion Fluffy_Pillow 48308.1/63371: 76% mana
3:00.191 aoe n arcane_explosion Fluffy_Pillow 44964.7/63371: 71% mana arcane_charge
3:01.499 aoe n arcane_explosion Fluffy_Pillow 41622.5/63371: 66% mana arcane_charge(2)
3:02.803 aoe n arcane_explosion Fluffy_Pillow 38275.2/63371: 60% mana arcane_charge(3), clearcasting
3:04.112 aoe o arcane_barrage Fluffy_Pillow 39934.2/63371: 63% mana arcane_charge(4)
3:05.417 aoe n arcane_explosion Fluffy_Pillow 44123.1/63371: 70% mana
3:06.726 aoe n arcane_explosion Fluffy_Pillow 40782.2/63371: 64% mana arcane_charge
3:08.032 aoe n arcane_explosion Fluffy_Pillow 37437.4/63371: 59% mana arcane_charge(2)
3:09.338 aoe n arcane_explosion Fluffy_Pillow 34092.7/63371: 54% mana arcane_charge(3)
3:10.643 aoe o arcane_barrage Fluffy_Pillow 30746.7/63371: 49% mana arcane_charge(4), clearcasting
3:11.950 aoe m arcane_orb Fluffy_Pillow 34938.1/63371: 55% mana clearcasting
3:13.257 aoe o arcane_barrage Fluffy_Pillow 36094.6/63371: 57% mana arcane_charge(4), clearcasting
3:14.562 aoe n arcane_explosion Fluffy_Pillow 40283.4/63371: 64% mana clearcasting
3:15.867 aoe n arcane_explosion Fluffy_Pillow 41937.4/63371: 66% mana arcane_charge
3:17.173 aoe n arcane_explosion Fluffy_Pillow 38592.7/63371: 61% mana arcane_charge(2)
3:18.480 aoe n arcane_explosion Fluffy_Pillow 35249.2/63371: 56% mana arcane_charge(3)
3:19.787 aoe o arcane_barrage Fluffy_Pillow 31905.8/63371: 50% mana arcane_charge(4)
3:21.096 aoe n arcane_explosion Fluffy_Pillow 36099.7/63371: 57% mana
3:22.404 aoe n arcane_explosion Fluffy_Pillow 32757.5/63371: 52% mana arcane_charge
3:23.713 aoe n arcane_explosion Fluffy_Pillow 29416.5/63371: 46% mana arcane_charge(2)
3:25.020 aoe n arcane_explosion Fluffy_Pillow 26073.1/63371: 41% mana arcane_charge(3), clearcasting
3:26.326 aoe o arcane_barrage Fluffy_Pillow 27728.3/63371: 44% mana arcane_charge(4)
3:27.632 aoe j touch_of_the_magi Fluffy_Pillow 31918.5/63371: 50% mana
3:28.938 aoe l rune_of_power Fluffy_Pillow 31073.7/63371: 49% mana arcane_charge(4)
3:30.244 aoe o arcane_barrage Fluffy_Pillow 32729.0/63371: 52% mana arcane_charge(4), rune_of_power
3:31.550 aoe n arcane_explosion Fluffy_Pillow 36919.1/63371: 58% mana rune_of_power
3:32.857 aoe n arcane_explosion Fluffy_Pillow 33575.6/63371: 53% mana arcane_charge, rune_of_power
3:34.164 aoe n arcane_explosion Fluffy_Pillow 30232.2/63371: 48% mana arcane_charge(2), rune_of_power
3:35.472 aoe n arcane_explosion Fluffy_Pillow 26889.9/63371: 42% mana arcane_charge(3), rune_of_power
3:36.778 aoe o arcane_barrage Fluffy_Pillow 23545.2/63371: 37% mana arcane_charge(4), clearcasting, rune_of_power
3:38.086 aoe m arcane_orb Fluffy_Pillow 27737.9/63371: 44% mana clearcasting, rune_of_power
3:39.393 aoe o arcane_barrage Fluffy_Pillow 28894.4/63371: 46% mana arcane_charge(4), clearcasting, rune_of_power
3:40.698 aoe n arcane_explosion Fluffy_Pillow 33083.2/63371: 52% mana clearcasting, rune_of_power
3:42.005 aoe n arcane_explosion Fluffy_Pillow 34739.8/63371: 55% mana arcane_charge, rune_of_power
3:43.311 aoe n arcane_explosion Fluffy_Pillow 31395.0/63371: 50% mana arcane_charge(2)
3:44.618 aoe n arcane_explosion Fluffy_Pillow 28051.6/63371: 44% mana arcane_charge(3), clearcasting
3:45.924 aoe o arcane_barrage Fluffy_Pillow 29706.8/63371: 47% mana arcane_charge(4)
3:47.230 aoe n arcane_explosion Fluffy_Pillow 33896.9/63371: 53% mana
3:48.536 aoe n arcane_explosion Fluffy_Pillow 30552.2/63371: 48% mana arcane_charge
3:49.842 aoe n arcane_explosion Fluffy_Pillow 27207.5/63371: 43% mana arcane_charge(2)
3:51.148 aoe n arcane_explosion Fluffy_Pillow 23862.7/63371: 38% mana arcane_charge(3)
3:52.456 aoe o arcane_barrage Fluffy_Pillow 20520.5/63371: 32% mana arcane_charge(4)
3:53.763 aoe n arcane_explosion Fluffy_Pillow 24711.9/63371: 39% mana
3:55.069 aoe n arcane_explosion Fluffy_Pillow 21367.2/63371: 34% mana arcane_charge
3:56.376 aoe n arcane_explosion Fluffy_Pillow 18023.7/63371: 28% mana arcane_charge(2)
3:57.683 aoe n arcane_explosion Fluffy_Pillow 14680.2/63371: 23% mana arcane_charge(3)
3:58.989 aoe o arcane_barrage Fluffy_Pillow 11335.5/63371: 18% mana arcane_charge(4), clearcasting
4:00.296 aoe m arcane_orb Fluffy_Pillow 15526.9/63371: 25% mana clearcasting
4:01.603 aoe o arcane_barrage Fluffy_Pillow 16683.4/63371: 26% mana arcane_charge(4), clearcasting
4:02.911 aoe n arcane_explosion Fluffy_Pillow 20876.1/63371: 33% mana clearcasting
4:04.218 aoe n arcane_explosion Fluffy_Pillow 22532.6/63371: 36% mana arcane_charge
4:05.525 aoe n arcane_explosion Fluffy_Pillow 19189.1/63371: 30% mana arcane_charge(2)
4:06.833 aoe n arcane_explosion Fluffy_Pillow 15846.9/63371: 25% mana arcane_charge(3)
4:08.140 aoe o arcane_barrage Fluffy_Pillow 12503.4/63371: 20% mana arcane_charge(4), clearcasting
4:09.446 aoe n arcane_explosion Fluffy_Pillow 16693.6/63371: 26% mana clearcasting
4:10.751 aoe n arcane_explosion Fluffy_Pillow 18347.6/63371: 29% mana arcane_charge
4:12.058 aoe n arcane_explosion Fluffy_Pillow 15004.1/63371: 24% mana arcane_charge(2)
4:13.365 aoe n arcane_explosion Fluffy_Pillow 11660.6/63371: 18% mana arcane_charge(3)
4:14.671 aoe o arcane_barrage Fluffy_Pillow 8315.9/63371: 13% mana arcane_charge(4)
4:15.978 aoe j touch_of_the_magi Fluffy_Pillow 12507.3/63371: 20% mana
4:17.282 aoe k arcane_power Fluffy_Pillow 11660.0/63371: 18% mana arcane_charge(4)
4:17.282 shared_cds t berserking Fluffy_Pillow 11660.0/63371: 18% mana arcane_charge(4), arcane_power, rune_of_power
4:17.282 aoe o arcane_barrage Fluffy_Pillow 11660.0/63371: 18% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:18.472 aoe n arcane_explosion Fluffy_Pillow 15703.1/63371: 25% mana berserking, arcane_power, rune_of_power
4:19.660 aoe n arcane_explosion Fluffy_Pillow 14708.8/63371: 23% mana berserking, arcane_charge, arcane_power, rune_of_power
4:20.848 aoe n arcane_explosion Fluffy_Pillow 13714.5/63371: 22% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:22.036 aoe n arcane_explosion Fluffy_Pillow 12720.2/63371: 20% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:23.225 aoe o arcane_barrage Fluffy_Pillow 11727.2/63371: 19% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:24.415 aoe m arcane_orb Fluffy_Pillow 15770.3/63371: 25% mana berserking, arcane_power, rune_of_power
4:25.603 aoe o arcane_barrage Fluffy_Pillow 17026.0/63371: 27% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:26.793 aoe n arcane_explosion Fluffy_Pillow 21069.1/63371: 33% mana berserking, arcane_power, rune_of_power
4:27.982 aoe n arcane_explosion Fluffy_Pillow 20076.1/63371: 32% mana berserking, arcane_charge, arcane_power, rune_of_power
4:29.173 aoe n arcane_explosion Fluffy_Pillow 19085.6/63371: 30% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:30.361 aoe n arcane_explosion Fluffy_Pillow 18091.3/63371: 29% mana arcane_charge(3), arcane_power
4:31.666 aoe l rune_of_power Fluffy_Pillow 17245.3/63371: 27% mana arcane_charge(4), arcane_power
4:32.973 aoe o arcane_barrage Fluffy_Pillow 18901.8/63371: 30% mana arcane_charge(4), rune_of_power
4:34.280 aoe n arcane_explosion Fluffy_Pillow 23093.2/63371: 36% mana rune_of_power
4:35.588 shared_cds r use_mana_gem arcane 19751.0/63371: 31% mana arcane_charge, rune_of_power
4:35.588 aoe n arcane_explosion Fluffy_Pillow 26088.1/63371: 41% mana arcane_charge, rune_of_power
4:36.895 aoe n arcane_explosion Fluffy_Pillow 22744.6/63371: 36% mana arcane_charge(2), rune_of_power
4:38.202 aoe n arcane_explosion Fluffy_Pillow 19401.2/63371: 31% mana arcane_charge(3), clearcasting, rune_of_power
4:39.508 aoe o arcane_barrage Fluffy_Pillow 21056.4/63371: 33% mana arcane_charge(4), rune_of_power
4:40.813 aoe n arcane_explosion Fluffy_Pillow 25245.3/63371: 40% mana rune_of_power
4:42.118 aoe n arcane_explosion Fluffy_Pillow 21899.3/63371: 35% mana arcane_charge, rune_of_power
4:43.424 aoe n arcane_explosion Fluffy_Pillow 18554.5/63371: 29% mana arcane_charge(2), rune_of_power
4:44.731 aoe n arcane_explosion Fluffy_Pillow 15211.1/63371: 24% mana arcane_charge(3), rune_of_power
4:46.036 aoe o arcane_barrage Fluffy_Pillow 11865.1/63371: 19% mana arcane_charge(4)
4:47.343 aoe m arcane_orb Fluffy_Pillow 16056.5/63371: 25% mana
4:48.647 aoe o arcane_barrage Fluffy_Pillow 17209.2/63371: 27% mana arcane_charge(4)
4:49.953 aoe n arcane_explosion Fluffy_Pillow 21399.3/63371: 34% mana
4:51.260 aoe n arcane_explosion Fluffy_Pillow 18055.8/63371: 28% mana arcane_charge
4:52.567 aoe n arcane_explosion Fluffy_Pillow 14712.4/63371: 23% mana arcane_charge(2), clearcasting
4:53.873 aoe n arcane_explosion Fluffy_Pillow 16367.6/63371: 26% mana arcane_charge(3)
4:55.179 aoe o arcane_barrage Fluffy_Pillow 13022.9/63371: 21% mana arcane_charge(4)
4:56.487 aoe n arcane_explosion Fluffy_Pillow 17215.5/63371: 27% mana
4:57.793 aoe n arcane_explosion Fluffy_Pillow 13870.8/63371: 22% mana arcane_charge
4:59.098 aoe n arcane_explosion Fluffy_Pillow 10524.8/63371: 17% mana arcane_charge(2), clearcasting
5:00.406 aoe n arcane_explosion Fluffy_Pillow 12182.6/63371: 19% mana arcane_charge(3)
5:01.711 aoe o arcane_barrage Fluffy_Pillow 8836.6/63371: 14% mana arcane_charge(4)
5:03.018 aoe n arcane_explosion Fluffy_Pillow 13028.0/63371: 21% mana
5:04.323 aoe n arcane_explosion Fluffy_Pillow 9682.0/63371: 15% mana arcane_charge
5:05.627 aoe n arcane_explosion Fluffy_Pillow 6334.7/63371: 10% mana arcane_charge(2)
5:06.934 aoe p evocation Fluffy_Pillow 2991.2/63371: 5% mana arcane_charge(3)
5:11.279 aoe n arcane_explosion Fluffy_Pillow 56837.1/63371: 90% mana arcane_charge(3)
5:12.586 aoe o arcane_barrage Fluffy_Pillow 53493.7/63371: 84% mana arcane_charge(4), clearcasting
5:13.893 aoe m arcane_orb Fluffy_Pillow 57685.1/63371: 91% mana clearcasting
5:15.199 aoe o arcane_barrage Fluffy_Pillow 58840.3/63371: 93% mana arcane_charge(4), clearcasting
5:16.504 aoe n arcane_explosion Fluffy_Pillow 63029.2/63371: 99% mana clearcasting
5:17.810 aoe j touch_of_the_magi Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge
5:19.116 aoe l rune_of_power Fluffy_Pillow 60876.5/63371: 96% mana arcane_charge(4)
5:20.422 aoe o arcane_barrage Fluffy_Pillow 62531.8/63371: 99% mana arcane_charge(4), rune_of_power
5:21.729 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
5:23.035 aoe n arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power
5:24.340 aoe n arcane_explosion Fluffy_Pillow 56680.7/63371: 89% mana arcane_charge(2), rune_of_power
5:25.648 aoe n arcane_explosion Fluffy_Pillow 53338.5/63371: 84% mana arcane_charge(3), rune_of_power
5:26.955 aoe o arcane_barrage Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4), rune_of_power
5:28.261 aoe n arcane_explosion Fluffy_Pillow 54185.1/63371: 86% mana rune_of_power
5:29.569 aoe n arcane_explosion Fluffy_Pillow 50842.9/63371: 80% mana arcane_charge, rune_of_power
5:30.874 aoe n arcane_explosion Fluffy_Pillow 47496.9/63371: 75% mana arcane_charge(2), rune_of_power
5:32.179 aoe n arcane_explosion Fluffy_Pillow 44150.9/63371: 70% mana arcane_charge(3), rune_of_power
5:33.486 aoe o arcane_barrage Fluffy_Pillow 40807.4/63371: 64% mana arcane_charge(4)
5:34.791 aoe m arcane_orb Fluffy_Pillow 44996.3/63371: 71% mana
5:36.098 aoe o arcane_barrage Fluffy_Pillow 46152.8/63371: 73% mana arcane_charge(4)
5:37.403 aoe n arcane_explosion Fluffy_Pillow 50341.7/63371: 79% mana
5:38.708 aoe n arcane_explosion Fluffy_Pillow 46995.7/63371: 74% mana arcane_charge
5:40.015 aoe n arcane_explosion Fluffy_Pillow 43652.2/63371: 69% mana arcane_charge(2)
5:41.319 aoe n arcane_explosion Fluffy_Pillow 40304.9/63371: 64% mana arcane_charge(3)
5:42.626 aoe o arcane_barrage Fluffy_Pillow 36961.5/63371: 58% mana arcane_charge(4)
5:43.933 aoe n arcane_explosion Fluffy_Pillow 41152.8/63371: 65% mana
5:45.241 aoe n arcane_explosion Fluffy_Pillow 37810.6/63371: 60% mana arcane_charge, clearcasting
5:46.548 aoe n arcane_explosion Fluffy_Pillow 39467.2/63371: 62% mana arcane_charge(2)
5:47.855 aoe n arcane_explosion Fluffy_Pillow 36123.7/63371: 57% mana arcane_charge(3)
5:49.161 aoe o arcane_barrage Fluffy_Pillow 32779.0/63371: 52% mana arcane_charge(4)
5:50.467 aoe n arcane_explosion Fluffy_Pillow 36969.1/63371: 58% mana
5:51.774 aoe n arcane_explosion Fluffy_Pillow 33625.6/63371: 53% mana arcane_charge
5:53.081 aoe n arcane_explosion Fluffy_Pillow 30282.1/63371: 48% mana arcane_charge(2)
5:54.386 aoe n arcane_explosion Fluffy_Pillow 26936.1/63371: 43% mana arcane_charge(3)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Simulation & Raid Information

Iterations: 1233
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.1 )

Performance:

Total Events Processed: 22540305
Max Event Queue: 267
Sim Seconds: 370013
CPU Seconds: 45.1406
Physical Seconds: 11.8420
Speed Up: 8197

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Forgelite Kyrian_Forgelite arcane_barrage 44425 1173048 3909 33.19 5925 11868 55.4 166.0 19.3% 0.0% 0.0% 0.0% 5.42sec 1173048 300.09sec
Kyrian_Forgelite Kyrian_Forgelite arcane_echo 342232 111684 372 35.60 526 1053 59.4 178.1 19.2% 0.0% 0.0% 0.0% 4.70sec 111684 300.09sec
Kyrian_Forgelite Kyrian_Forgelite arcane_explosion 1449 1336733 4454 89.17 2512 5030 148.7 446.0 19.3% 0.0% 0.0% 0.0% 1.99sec 1336733 300.09sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.09sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb_bolt 153640 253386 844 7.67 5505 11054 38.4 38.4 19.8% 0.0% 0.0% 0.0% 24.10sec 253386 300.09sec
Kyrian_Forgelite Kyrian_Forgelite arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 131.66sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 263.08sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.77sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite deathly_eruption 322256 20362 68 2.94 1164 2327 14.7 14.7 19.2% 0.0% 0.0% 0.0% 1.77sec 20362 300.09sec
Kyrian_Forgelite Kyrian_Forgelite evocation 12051 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 175.64sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite frostbolt 116 1781 6 0.20 1481 2961 0.0 1.0 20.3% 0.0% 0.0% 0.0% 0.00sec 1781 300.09sec
Kyrian_Forgelite Kyrian_Forgelite mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite_mirror_image frostbolt 59638 5789 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5789 40.00sec
Kyrian_Forgelite Kyrian_Forgelite potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark 307443 31733 106 1.86 2857 5754 9.3 9.3 19.3% 0.0% 0.0% 0.0% 33.83sec 54419 300.09sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark ticks -307443 22686 76 12.10 315 630 9.3 60.5 19.1% 0.0% 0.0% 0.0% 33.83sec 54419 300.09sec
Kyrian_Forgelite Kyrian_Forgelite rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 52.27sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.44sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi_explosion 210833 272192 907 3.56 15307 0 5.9 17.8 0.0% 0.0% 0.0% 0.0% 54.34sec 272192 300.09sec
Kyrian_Forgelite Kyrian_Forgelite use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.73sec 0 300.09sec
Kyrian_Forgelite Kyrian_Forgelite_bron anima_cannon 332525 0 0 0.00 0 0 7.6 0.0 0.0% 0.0% 0.0% 0.0% 22.58sec 0 57.03sec
Kyrian_Forgelite Kyrian_Forgelite_bron goliath_support 332526 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 12.14sec 0 57.03sec
Kyrian_Forgelite Kyrian_Forgelite_bron melee 0 4112 72 18.32 198 396 17.4 17.4 19.4% 0.0% 0.0% 0.0% 9.09sec 5874 57.03sec
Kyrian_Forgelite Kyrian_Forgelite_bron smash 341163 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 22.66sec 0 57.03sec
Kyrian_Pelagos Kyrian_Pelagos arcane_barrage 44425 1184343 3947 33.21 5974 11992 55.4 166.1 19.2% 0.0% 0.0% 0.0% 5.41sec 1184343 300.09sec
Kyrian_Pelagos Kyrian_Pelagos arcane_echo 342232 111993 373 35.71 526 1053 59.5 178.6 19.2% 0.0% 0.0% 0.0% 4.67sec 111993 300.09sec
Kyrian_Pelagos Kyrian_Pelagos arcane_explosion 1449 1356139 4519 89.25 2547 5097 148.8 446.4 19.3% 0.0% 0.0% 0.0% 1.98sec 1356139 300.09sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.15sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb_bolt 153640 258000 860 7.67 5635 11285 38.4 38.4 19.2% 0.0% 0.0% 0.0% 24.15sec 258000 300.09sec
Kyrian_Pelagos Kyrian_Pelagos arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 132.24sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 263.87sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.76sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos deathly_eruption 322256 20439 68 2.94 1164 2327 14.7 14.7 19.6% 0.0% 0.0% 0.0% 1.76sec 20439 300.09sec
Kyrian_Pelagos Kyrian_Pelagos evocation 12051 0 0 0.00 0 0 0.9 0.0 0.0% 0.0% 0.0% 0.0% 165.41sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos frostbolt 116 1765 6 0.20 1481 2961 0.0 1.0 19.2% 0.0% 0.0% 0.0% 0.00sec 1765 300.09sec
Kyrian_Pelagos Kyrian_Pelagos mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos_mirror_image frostbolt 59638 5797 145 135.00 54 108 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 5797 40.00sec
Kyrian_Pelagos Kyrian_Pelagos potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark 307443 31696 106 1.87 2850 5683 9.3 9.3 19.4% 0.0% 0.0% 0.0% 33.65sec 54539 300.09sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark ticks -307443 22842 76 12.13 316 630 9.3 60.6 19.4% 0.0% 0.0% 0.0% 33.65sec 54539 300.09sec
Kyrian_Pelagos Kyrian_Pelagos rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 52.00sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.15sec 0 300.09sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi_explosion 210833 281274 937 3.56 15783 0 5.9 17.8 0.0% 0.0% 0.0% 0.0% 54.07sec 281274 300.09sec
Kyrian_Pelagos Kyrian_Pelagos use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.45sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni arcane_barrage 44425 946717 3155 29.63 5364 10665 49.5 148.2 19.3% 0.0% 0.0% 0.0% 5.65sec 946717 300.09sec
Necrolord_Emeni Necrolord_Emeni arcane_blast 30451 925342 3084 17.33 8937 17871 30.0 86.7 19.5% 0.0% 0.0% 0.0% 7.97sec 925342 300.09sec
Necrolord_Emeni Necrolord_Emeni arcane_echo 342232 81179 271 22.95 594 1185 38.3 114.8 19.2% 0.0% 0.0% 0.0% 7.34sec 81179 300.09sec
Necrolord_Emeni Necrolord_Emeni arcane_explosion 1449 1053940 3512 76.87 2296 4599 128.2 384.5 19.3% 0.0% 0.0% 0.0% 2.13sec 1053940 300.09sec
Necrolord_Emeni Necrolord_Emeni arcane_orb 153626 0 0 0.00 0 0 11.7 0.0 0.0% 0.0% 0.0% 0.0% 24.67sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni arcane_orb_bolt 153640 208583 695 6.99 4995 9983 35.0 35.0 19.5% 0.0% 0.0% 0.0% 24.66sec 208583 300.09sec
Necrolord_Emeni Necrolord_Emeni arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 126.32sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 253.07sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni deathborne 324220 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 253.28sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni deathly_fixation 322253 0 0 0.00 0 0 13.7 0.0 0.0% 0.0% 0.0% 0.0% 1.79sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni deathly_eruption 322256 18990 63 2.73 1164 2327 13.7 13.7 19.4% 0.0% 0.0% 0.0% 1.79sec 18990 300.09sec
Necrolord_Emeni Necrolord_Emeni evocation 12051 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 173.75sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni frostbolt 116 1757 6 0.20 1481 2961 0.0 1.0 18.7% 0.0% 0.0% 0.0% 0.00sec 1757 300.09sec
Necrolord_Emeni Necrolord_Emeni mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni_mirror_image frostbolt 59638 6503 163 135.00 61 121 90.0 90.0 19.0% 0.0% 0.0% 0.0% 1.29sec 6503 40.00sec
Necrolord_Emeni Necrolord_Emeni potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni presence_of_mind 205025 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 251.14sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.08sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.37sec 0 300.09sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi_explosion 210833 295794 986 3.73 15871 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.28sec 295794 300.09sec
Necrolord_Emeni Necrolord_Emeni use_mana_gem 5405 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.95sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth arcane_barrage 44425 929421 3097 29.65 5259 10500 49.5 148.3 19.3% 0.0% 0.0% 0.0% 5.65sec 929421 300.09sec
Necrolord_Marileth Necrolord_Marileth arcane_blast 30451 802845 2675 17.31 7769 15513 30.0 86.6 19.4% 0.0% 0.0% 0.0% 8.02sec 802845 300.09sec
Necrolord_Marileth Necrolord_Marileth arcane_echo 342232 75478 252 22.93 552 1103 38.2 114.7 19.3% 0.0% 0.0% 0.0% 7.33sec 75478 300.09sec
Necrolord_Marileth Necrolord_Marileth arcane_explosion 1449 1043044 3476 76.92 2272 4541 128.2 384.7 19.3% 0.0% 0.0% 0.0% 2.13sec 1043044 300.09sec
Necrolord_Marileth Necrolord_Marileth arcane_orb 153626 0 0 0.00 0 0 11.7 0.0 0.0% 0.0% 0.0% 0.0% 24.65sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth arcane_orb_bolt 153640 203118 677 6.98 4881 9749 34.9 34.9 19.3% 0.0% 0.0% 0.0% 24.66sec 203118 300.09sec
Necrolord_Marileth Necrolord_Marileth arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 126.37sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 253.08sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth deathborne 324220 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 253.33sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth deathly_fixation 322253 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 1.79sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth deathly_eruption 322256 18843 63 2.72 1164 2327 13.6 13.6 19.0% 0.0% 0.0% 0.0% 1.79sec 18843 300.09sec
Necrolord_Marileth Necrolord_Marileth evocation 12051 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 175.95sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth frostbolt 116 1779 6 0.20 1481 2961 0.0 1.0 20.1% 0.0% 0.0% 0.0% 0.00sec 1779 300.09sec
Necrolord_Marileth Necrolord_Marileth mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth_mirror_image frostbolt 59638 5783 145 135.00 54 108 90.0 90.0 19.1% 0.0% 0.0% 0.0% 1.29sec 5783 40.00sec
Necrolord_Marileth Necrolord_Marileth potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth presence_of_mind 205025 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 251.82sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.08sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.35sec 0 300.09sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi_explosion 210833 270920 903 3.73 14544 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.25sec 270920 300.09sec
Necrolord_Marileth Necrolord_Marileth use_mana_gem 5405 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.90sec 0 300.09sec
NightFae_Dream NightFae_Dream arcane_barrage 44425 1169319 3897 32.56 6021 12026 54.4 162.8 19.4% 0.0% 0.0% 0.0% 5.53sec 1169319 300.09sec
NightFae_Dream NightFae_Dream arcane_echo 342232 85489 285 24.75 579 1155 41.3 123.8 19.4% 0.0% 0.0% 0.0% 6.95sec 85489 300.09sec
NightFae_Dream NightFae_Dream arcane_explosion 1449 1340915 4468 85.44 2629 5262 142.4 427.3 19.3% 0.0% 0.0% 0.0% 2.08sec 1340915 300.09sec
NightFae_Dream NightFae_Dream arcane_orb 153626 0 0 0.00 0 0 13.4 0.0 0.0% 0.0% 0.0% 0.0% 22.93sec 0 300.09sec
NightFae_Dream NightFae_Dream arcane_orb_bolt 153640 260555 868 8.04 5415 10892 40.2 40.2 19.4% 0.0% 0.0% 0.0% 22.93sec 260555 300.09sec
NightFae_Dream NightFae_Dream arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.20sec 0 300.09sec
NightFae_Dream NightFae_Dream berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.75sec 0 300.09sec
NightFae_Dream NightFae_Dream conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream NightFae_Dream deathly_fixation 322253 0 0 0.00 0 0 18.7 0.0 0.0% 0.0% 0.0% 0.0% 9.50sec 0 300.09sec
NightFae_Dream NightFae_Dream deathly_eruption 322256 25932 86 3.75 1164 2327 18.7 18.7 18.9% 0.0% 0.0% 0.0% 9.50sec 25932 300.09sec
NightFae_Dream NightFae_Dream evocation 12051 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream NightFae_Dream flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream NightFae_Dream food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream NightFae_Dream frostbolt 116 1750 6 0.20 1481 2961 0.0 1.0 18.2% 0.0% 0.0% 0.0% 0.00sec 1750 300.09sec
NightFae_Dream NightFae_Dream mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream NightFae_Dream_mirror_image frostbolt 59638 5791 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5791 40.00sec
NightFae_Dream NightFae_Dream potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.45sec 0 300.09sec
NightFae_Dream NightFae_Dream rune_of_power 116011 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 47.12sec 0 300.09sec
NightFae_Dream NightFae_Dream shifting_power ticks -314791 118412 395 4.82 1372 2745 6.1 24.1 19.5% 0.0% 0.0% 0.0% 48.45sec 118412 300.09sec
NightFae_Dream NightFae_Dream touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.82sec 0 300.09sec
NightFae_Dream NightFae_Dream touch_of_the_magi_explosion 210833 259236 864 3.96 13101 0 6.6 19.8 0.0% 0.0% 0.0% 0.0% 48.69sec 259236 300.09sec
NightFae_Dream NightFae_Dream use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.73sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB arcane_barrage 44425 1186157 3953 32.55 6100 12238 54.3 162.8 19.4% 0.0% 0.0% 0.0% 5.54sec 1186157 300.09sec
NightFae_Dream_SB NightFae_Dream_SB arcane_echo 342232 86504 288 24.77 586 1171 41.3 123.9 19.2% 0.0% 0.0% 0.0% 6.94sec 86504 300.09sec
NightFae_Dream_SB NightFae_Dream_SB arcane_explosion 1449 1357256 4523 85.45 2664 5326 142.5 427.4 19.2% 0.0% 0.0% 0.0% 2.08sec 1357256 300.09sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb 153626 0 0 0.00 0 0 13.4 0.0 0.0% 0.0% 0.0% 0.0% 22.94sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb_bolt 153640 265046 883 8.03 5519 11091 40.2 40.2 19.3% 0.0% 0.0% 0.0% 22.93sec 265046 300.09sec
NightFae_Dream_SB NightFae_Dream_SB arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.20sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.74sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB deathly_fixation 322253 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 9.55sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB deathly_eruption 322256 26230 87 3.72 1181 2363 18.6 18.6 19.3% 0.0% 0.0% 0.0% 9.55sec 26230 300.09sec
NightFae_Dream_SB NightFae_Dream_SB evocation 12051 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB frostbolt 116 1791 6 0.20 1520 3040 0.0 1.0 17.8% 0.0% 0.0% 0.0% 0.00sec 1791 300.09sec
NightFae_Dream_SB NightFae_Dream_SB mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB_mirror_image frostbolt 59638 5873 147 135.00 55 109 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 5873 40.00sec
NightFae_Dream_SB NightFae_Dream_SB potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.46sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB rune_of_power 116011 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 47.10sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB shifting_power ticks -314791 119732 399 4.81 1389 2779 6.1 24.1 19.4% 0.0% 0.0% 0.0% 48.46sec 119732 300.09sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.82sec 0 300.09sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi_explosion 210833 263672 879 3.96 13330 0 6.6 19.8 0.0% 0.0% 0.0% 0.0% 48.70sec 263672 300.09sec
NightFae_Dream_SB NightFae_Dream_SB use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.85sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon arcane_barrage 44425 1193158 3976 32.56 6149 12277 54.4 162.9 19.2% 0.0% 0.0% 0.0% 5.53sec 1193158 300.09sec
NightFae_Koraylon NightFae_Koraylon arcane_echo 342232 88550 295 24.75 599 1198 41.3 123.8 19.4% 0.0% 0.0% 0.0% 6.94sec 88550 300.09sec
NightFae_Koraylon NightFae_Koraylon arcane_explosion 1449 1382165 4606 85.45 2709 5417 142.5 427.4 19.4% 0.0% 0.0% 0.0% 2.08sec 1382165 300.09sec
NightFae_Koraylon NightFae_Koraylon arcane_orb 153626 0 0 0.00 0 0 13.4 0.0 0.0% 0.0% 0.0% 0.0% 22.92sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon arcane_orb_bolt 153640 268250 894 8.04 5596 11230 40.2 40.2 19.1% 0.0% 0.0% 0.0% 22.92sec 268250 300.09sec
NightFae_Koraylon NightFae_Koraylon arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.18sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.74sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon deathly_fixation 322253 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 9.70sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon deathly_eruption 322256 28065 94 3.75 1254 2507 18.8 18.8 19.3% 0.0% 0.0% 0.0% 9.70sec 28065 300.09sec
NightFae_Koraylon NightFae_Koraylon evocation 12051 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon frostbolt 116 1962 7 0.20 1629 3257 0.0 1.0 20.5% 0.0% 0.0% 0.0% 0.00sec 1962 300.09sec
NightFae_Koraylon NightFae_Koraylon mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon_mirror_image frostbolt 59638 5788 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5788 40.00sec
NightFae_Koraylon NightFae_Koraylon potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.43sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon rune_of_power 116011 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 47.11sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon shifting_power ticks -314791 121289 404 4.81 1405 2809 6.1 24.1 19.6% 0.0% 0.0% 0.0% 48.44sec 121289 300.09sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.82sec 0 300.09sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi_explosion 210833 267964 893 3.96 13543 0 6.6 19.8 0.0% 0.0% 0.0% 0.0% 48.68sec 267964 300.09sec
NightFae_Koraylon NightFae_Koraylon use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.60sec 0 300.09sec
NightFae_Niya NightFae_Niya arcane_barrage 44425 1190739 3968 32.64 6119 12229 54.5 163.2 19.3% 0.0% 0.0% 0.0% 5.52sec 1190739 300.09sec
NightFae_Niya NightFae_Niya arcane_echo 342232 85364 284 24.75 578 1157 41.3 123.8 19.3% 0.0% 0.0% 0.0% 6.94sec 85364 300.09sec
NightFae_Niya NightFae_Niya arcane_explosion 1449 1372797 4575 85.74 2685 5358 142.9 428.8 19.3% 0.0% 0.0% 0.0% 2.07sec 1372797 300.09sec
NightFae_Niya NightFae_Niya arcane_orb 153626 0 0 0.00 0 0 13.4 0.0 0.0% 0.0% 0.0% 0.0% 22.99sec 0 300.09sec
NightFae_Niya NightFae_Niya arcane_orb_bolt 153640 265636 885 8.02 5555 11152 40.1 40.1 19.1% 0.0% 0.0% 0.0% 22.99sec 265636 300.09sec
NightFae_Niya NightFae_Niya arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.13sec 0 300.09sec
NightFae_Niya NightFae_Niya berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.64sec 0 300.09sec
NightFae_Niya NightFae_Niya conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Niya NightFae_Niya deathly_fixation 322253 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 9.52sec 0 300.09sec
NightFae_Niya NightFae_Niya deathly_eruption 322256 26002 87 3.75 1164 2327 18.8 18.8 19.1% 0.0% 0.0% 0.0% 9.52sec 26002 300.09sec
NightFae_Niya NightFae_Niya evocation 12051 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Niya NightFae_Niya flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Niya NightFae_Niya food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Niya NightFae_Niya frostbolt 116 1795 6 0.20 1481 2961 0.0 1.0 21.2% 0.0% 0.0% 0.0% 0.00sec 1795 300.09sec
NightFae_Niya NightFae_Niya mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
NightFae_Niya NightFae_Niya_mirror_image frostbolt 59638 5787 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5787 40.00sec
NightFae_Niya NightFae_Niya potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.40sec 0 300.09sec
NightFae_Niya NightFae_Niya rune_of_power 116011 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 47.11sec 0 300.09sec
NightFae_Niya NightFae_Niya shifting_power ticks -314791 118293 394 4.82 1372 2745 6.1 24.1 19.3% 0.0% 0.0% 0.0% 48.41sec 118293 300.09sec
NightFae_Niya NightFae_Niya touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.81sec 0 300.09sec
NightFae_Niya NightFae_Niya touch_of_the_magi_explosion 210833 265060 883 3.96 13395 0 6.6 19.8 0.0% 0.0% 0.0% 0.0% 48.68sec 265060 300.09sec
NightFae_Niya NightFae_Niya use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.71sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia arcane_barrage 44425 1183271 3943 34.55 5737 11496 57.7 172.8 19.3% 0.0% 0.0% 0.0% 5.20sec 1183271 300.09sec
Venthyr_Nadjia Venthyr_Nadjia arcane_echo 342232 83373 278 26.20 533 1067 43.7 131.1 19.3% 0.0% 0.0% 0.0% 6.44sec 83373 300.09sec
Venthyr_Nadjia Venthyr_Nadjia arcane_explosion 1449 1391572 4637 93.99 2483 4964 156.7 470.1 19.2% 0.0% 0.0% 0.0% 1.88sec 1391572 300.09sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.44sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb_bolt 153640 246180 820 7.89 5231 10458 39.4 39.4 19.3% 0.0% 0.0% 0.0% 23.44sec 246180 300.09sec
Venthyr_Nadjia Venthyr_Nadjia arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.26sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 254.45sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia deathly_fixation 322253 0 0 0.00 0 0 14.8 0.0 0.0% 0.0% 0.0% 0.0% 1.75sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia deathly_eruption 322256 20554 68 2.95 1164 2327 14.8 14.8 19.7% 0.0% 0.0% 0.0% 1.75sec 20554 300.09sec
Venthyr_Nadjia Venthyr_Nadjia evocation 12051 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 173.68sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia frostbolt 116 1776 6 0.20 1481 2961 0.0 1.0 20.0% 0.0% 0.0% 0.0% 0.00sec 1776 300.09sec
Venthyr_Nadjia Venthyr_Nadjia mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia_mirror_image frostbolt 59638 5793 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5793 40.00sec
Venthyr_Nadjia Venthyr_Nadjia mirrors_of_torment 314793 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 130.07sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia agonizing_backlash 320035 20796 69 1.13 3100 6164 5.7 5.7 18.9% 0.0% 0.0% 0.0% 52.78sec 20796 300.09sec
Venthyr_Nadjia Venthyr_Nadjia tormenting_backlash 317589 20961 70 0.55 6403 12815 2.8 2.8 18.9% 0.0% 0.0% 0.0% 131.95sec 20961 300.09sec
Venthyr_Nadjia Venthyr_Nadjia potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.82sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.76sec 0 300.09sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi_explosion 210833 239634 799 3.71 12917 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.67sec 239634 300.09sec
Venthyr_Nadjia Venthyr_Nadjia use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.30sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar arcane_barrage 44425 1184468 3947 34.17 5817 11637 57.0 170.9 19.2% 0.0% 0.0% 0.0% 5.26sec 1184468 300.09sec
Venthyr_Theotar Venthyr_Theotar arcane_echo 342232 81782 273 25.78 531 1063 43.0 128.9 19.4% 0.0% 0.0% 0.0% 6.55sec 81782 300.09sec
Venthyr_Theotar Venthyr_Theotar arcane_explosion 1449 1392188 4639 92.15 2535 5061 153.6 460.9 19.2% 0.0% 0.0% 0.0% 1.92sec 1392188 300.09sec
Venthyr_Theotar Venthyr_Theotar arcane_orb 153626 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.50sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar arcane_orb_bolt 153640 251447 838 7.87 5349 10695 39.4 39.4 19.5% 0.0% 0.0% 0.0% 23.50sec 251447 300.09sec
Venthyr_Theotar Venthyr_Theotar arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.11sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.32sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar deathly_fixation 322253 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar deathly_eruption 322256 20321 68 2.93 1164 2327 14.6 14.6 19.2% 0.0% 0.0% 0.0% 1.78sec 20321 300.09sec
Venthyr_Theotar Venthyr_Theotar evocation 12051 0 0 0.00 0 0 0.8 0.0 0.0% 0.0% 0.0% 0.0% 197.98sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar frostbolt 116 1757 6 0.20 1481 2961 0.0 1.0 18.7% 0.0% 0.0% 0.0% 0.00sec 1757 300.09sec
Venthyr_Theotar Venthyr_Theotar mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar_mirror_image frostbolt 59638 5783 145 135.00 54 108 90.0 90.0 19.1% 0.0% 0.0% 0.0% 1.29sec 5783 40.00sec
Venthyr_Theotar Venthyr_Theotar mirrors_of_torment 314793 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 138.63sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar agonizing_backlash 320035 19212 64 1.06 3036 6045 5.3 5.3 19.6% 0.0% 0.0% 0.0% 55.35sec 19212 300.09sec
Venthyr_Theotar Venthyr_Theotar tormenting_backlash 317589 19587 65 0.52 6390 12773 2.6 2.6 18.8% 0.0% 0.0% 0.0% 139.81sec 19587 300.09sec
Venthyr_Theotar Venthyr_Theotar potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.78sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.76sec 0 300.09sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi_explosion 210833 244307 814 3.65 13385 0 6.1 18.3 0.0% 0.0% 0.0% 0.0% 52.65sec 244307 300.09sec
Venthyr_Theotar Venthyr_Theotar use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 124.32sec 0 300.09sec
arcane arcane arcane_barrage 44425 1176052 3919 34.30 5735 11499 57.3 171.6 19.5% 0.0% 0.0% 0.0% 5.26sec 1176052 300.09sec
arcane arcane arcane_echo 342232 70264 234 22.17 531 1061 37.0 110.9 19.3% 0.0% 0.0% 0.0% 7.66sec 70264 300.09sec
arcane arcane arcane_explosion 1449 1376407 4587 92.84 2486 4973 154.8 464.4 19.2% 0.0% 0.0% 0.0% 1.92sec 1376407 300.09sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.63sec 0 300.09sec
arcane arcane arcane_orb_bolt 153640 245732 819 7.85 5252 10484 39.3 39.3 19.3% 0.0% 0.0% 0.0% 23.63sec 245732 300.09sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.37sec 0 300.09sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 256.62sec 0 300.09sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
arcane arcane deathly_fixation 322253 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 1.73sec 0 300.09sec
arcane arcane deathly_eruption 322256 19970 67 2.88 1164 2327 14.4 14.4 19.1% 0.0% 0.0% 0.0% 1.73sec 19970 300.09sec
arcane arcane evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 170.12sec 0 300.09sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
arcane arcane frostbolt 116 1758 6 0.20 1481 2961 0.0 1.0 18.7% 0.0% 0.0% 0.0% 0.00sec 1758 300.09sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
arcane arcane_mirror_image frostbolt 59638 5791 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5791 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.09sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.24sec 0 300.09sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.18sec 0 300.09sec
arcane arcane touch_of_the_magi_explosion 210833 156269 521 3.70 8464 0 6.2 18.5 0.0% 0.0% 0.0% 0.0% 52.10sec 156269 300.09sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 124.36sec 0 300.09sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
48839.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 40.7sec 8.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 104.2s

Stack Uptimes

  • Health Decade (0 - 10)_1:8.83%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 22.2sec 6.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 35.7s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.33%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 24.0sec 7.83% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 36.2s

Stack Uptimes

  • Health Decade (20 - 30)_1:7.84%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 30.3sec 10.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 42.3s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.15%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.53% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.1s / 49.1s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.53%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 38.7sec 13.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.4s / 54.0s

Stack Uptimes

  • Health Decade (50 - 60)_1:13.01%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 40.3sec 13.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:33.4s / 50.4s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.61%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 44.3sec 14.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:32.5s / 52.9s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.99%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 29.1sec 9.85% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.9s / 47.4s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.85%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 15.4sec 3.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.93%
Mirrors of Torment 2.7 0.0 137.3sec 138.3sec 13.2sec 11.84% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 165.8s
  • trigger_min/max:97.1s / 165.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.19%
  • mirrors_of_torment_2:5.30%
  • mirrors_of_torment_3:1.34%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Mirrors of Torment 2.9 0.0 128.7sec 129.5sec 13.3sec 12.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 162.6s
  • trigger_min/max:93.8s / 162.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.55%
  • mirrors_of_torment_2:5.67%
  • mirrors_of_torment_3:1.43%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Radiant Spark Vulnerability 9.4 27.6 33.2sec 7.8sec 4.8sec 14.93% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 59.5s
  • trigger_min/max:0.5s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.88%
  • radiant_spark_vulnerability_2:3.74%
  • radiant_spark_vulnerability_3:3.56%
  • radiant_spark_vulnerability_4:3.75%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Radiant Spark Vulnerability 9.3 27.5 33.4sec 7.9sec 4.8sec 14.86% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 56.6s
  • trigger_min/max:0.5s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.83%
  • radiant_spark_vulnerability_2:3.73%
  • radiant_spark_vulnerability_3:3.54%
  • radiant_spark_vulnerability_4:3.76%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Touch of the Magi 6.2 0.0 52.0sec 52.2sec 7.9sec 16.32% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 67.1s
  • trigger_min/max:46.3s / 67.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.32%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.44% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.4s
  • trigger_min/max:41.6s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.44%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.43% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.5s
  • trigger_min/max:40.2s / 56.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.43%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.44% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.5s
  • trigger_min/max:40.2s / 56.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.44%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.43% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.4s
  • trigger_min/max:40.3s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.43%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.6sec 52.8sec 7.9sec 16.11% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 67.4s
  • trigger_min/max:46.3s / 67.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.11%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.6sec 51.7sec 7.9sec 16.40% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 69.0s
  • trigger_min/max:46.3s / 69.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.40%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.2sec 54.3sec 7.9sec 15.70% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 69.7s
  • trigger_min/max:47.4s / 69.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.70%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.4sec 54.5sec 7.9sec 15.68% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 70.8s
  • trigger_min/max:47.4s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.68%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.2sec 51.4sec 7.9sec 16.49% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 70.2s
  • trigger_min/max:46.3s / 70.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.49%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.2sec 51.3sec 7.9sec 16.49% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 71.7s
  • trigger_min/max:46.3s / 71.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.49%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
Fluffy_Pillow Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1217
Mean 52054.85
Minimum 49733.49
Maximum 54696.59
Spread ( max - min ) 4963.10
Range [ ( max - min ) / 2 * 100% ] 4.77%
Standard Deviation 871.1262
5th Percentile 50743.24
95th Percentile 53463.43
( 95th Percentile - 5th Percentile ) 2720.19
Mean Distribution
Standard Deviation 24.9710
95.00% Confidence Interval ( 52005.91 - 52103.79 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1076
0.1 Scale Factor Error with Delta=300 6479
0.05 Scale Factor Error with Delta=300 25913
0.01 Scale Factor Error with Delta=300 647808
HPS
Fluffy_Pillow Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 341
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 18044443 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
31749.5 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 44.9sec 9.92% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 118.9s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.96%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.4sec 6.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 36.5s

Stack Uptimes

  • Health Decade (10 - 20)_1:7.01%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.6sec 8.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 37.8s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.73%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.5sec 10.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.6s / 42.2s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.91%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.0sec 11.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.4s / 44.5s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.73%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.3sec 11.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.9s / 51.0s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.91%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.4sec 12.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 43.2s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.62%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 40.8sec 13.79% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.5s / 49.6s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.79%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 27.8sec 9.41% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:14.4s / 44.5s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.41%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 15.6sec 3.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.99%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2179
death count pct 176.72
avg death time 296.38
min death time 241.05
max death time 356.03
dmg taken 10151600.38

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
enemy2 Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1217
Mean 33852.33
Minimum 32670.13
Maximum 35241.74
Spread ( max - min ) 2571.60
Range [ ( max - min ) / 2 * 100% ] 3.80%
Standard Deviation 489.6769
5th Percentile 33066.43
95th Percentile 34610.24
( 95th Percentile - 5th Percentile ) 1543.81
Mean Distribution
Standard Deviation 14.0367
95.00% Confidence Interval ( 33824.82 - 33879.84 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9
0.1% Error 804
0.1 Scale Factor Error with Delta=300 2047
0.05 Scale Factor Error with Delta=300 8188
0.01 Scale Factor Error with Delta=300 204693
HPS
enemy2 Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 341
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 11425978 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
32584.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 44.0sec 9.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 119.4s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.66%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.7sec 7.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 39.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:7.08%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 27.5sec 9.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 38.9s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.04%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 33.5sec 11.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.1s / 44.0s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.21%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 36.0sec 12.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.7s / 46.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:12.10%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 36.4sec 12.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.2s / 51.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.30%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 38.8sec 13.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.9s / 44.4s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.11%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.5sec 14.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.7s / 52.1s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.04%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 22.9sec 7.75% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:11.6s / 41.3s

Stack Uptimes

  • Health Decade (80 - 90)_1:7.75%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.9sec 3.76% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.5s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.76%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2179
death count pct 176.72
avg death time 296.38
min death time 241.05
max death time 356.03
dmg taken 10390149.88

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1217
Mean 300.09
Minimum 240.12
Maximum 359.87
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.95%
DPS
enemy3 Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1217
Mean 34647.76
Minimum 33487.73
Maximum 35871.81
Spread ( max - min ) 2384.08
Range [ ( max - min ) / 2 * 100% ] 3.44%
Standard Deviation 469.4944
5th Percentile 33851.80
95th Percentile 35369.89
( 95th Percentile - 5th Percentile ) 1518.09
Mean Distribution
Standard Deviation 13.4581
95.00% Confidence Interval ( 34621.38 - 34674.13 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 706
0.1 Scale Factor Error with Delta=300 1882
0.05 Scale Factor Error with Delta=300 7527
0.01 Scale Factor Error with Delta=300 188168
HPS
enemy3 Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 341
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 11065754 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.